Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ)

Shipped with Ice Packs
In Stock

Description

Protein Family and Conservation

The yqhQ protein belongs to the highly conserved Asp23 family and contains the domain of unknown function DUF322 . This protein family is remarkably widespread, found predominantly in Gram-positive bacteria including Firmicutes and Actinobacteria, as well as in the Deinococcus/Thermus group, Chlamydia, Thermotoga, and Bacteroides/Fusobacterium phyla .

The strong conservation of yqhQ across numerous bacterial species, coupled with its exceptionally high expression level in Bacillus subtilis, suggests it plays a fundamental role in bacterial physiology. Interestingly, while yqhQ was initially reported as essential in B. subtilis based on gene pair analysis , subsequent research has demonstrated it is dispensable, though its deletion leads to significant physiological consequences.

Role in Fatty Acid Metabolism

Recent research has revealed compelling evidence that yqhQ functions in the regulation of fatty acid biosynthesis in Bacillus subtilis. Specifically, yqhQ appears to control the activity of the acetyl-CoA carboxylase (ACCase) complex, which catalyzes the formation of malonyl-CoA, the committed step in fatty acid synthesis .

Deletion of the yqhQ gene induces the rapid acquisition of suppressor mutations, with the vast majority affecting subunits of the ACCase complex . This genetic compensation mechanism strongly supports a functional relationship between yqhQ and the ACCase complex. Furthermore, microscopic examination of yqhQ deletion mutants revealed the formation of lipophilic clusters in the polar regions of cells, indicating increased ACCase activity in the absence of yqhQ .

These findings collectively suggest that yqhQ functions as an inhibitor of ACCase activity, and its absence results in hyperactivity of the enzyme complex. This hyperactivity appears detrimental to the cell, provoking compensatory mutations that reduce ACCase activity .

Genetic and Functional Context

The yqhQ gene in B. subtilis exists in a conserved genomic context that provides additional insights into its functional role. Conserved gene clustering often indicates related protein functions or even physical interactions between encoded proteins .

In many bacterial species, yqhQ is co-expressed with yloU, a paralogous protein that also contains the DUF322 domain and belongs to the Asp23 family . Interestingly, while yqhQ deletion causes significant cellular disruption requiring compensatory mutations, deletion of yloU appears to have no detectable effect on B. subtilis, suggesting functional specialization between these paralogous proteins .

Recombinant Expression and Purification

Recombinant full-length Bacillus subtilis yqhQ protein can be successfully expressed in Escherichia coli expression systems. A common approach involves fusing the protein (amino acids 1-318) with an N-terminal histidine tag to facilitate purification . The resulting His-tagged yqhQ protein can be purified to greater than 90% purity as determined by SDS-PAGE analysis .

Table 1: Production Specifications for Recombinant yqhQ Protein

ParameterSpecification
SpeciesBacillus subtilis
Expression SystemE. coli
TagN-terminal His
Protein LengthFull Length (1-318)
FormLyophilized powder
Purity>90% (SDS-PAGE)
UniProt IDP54515
SynonymsyqhQ; BSU24490; Uncharacterized protein YqhQ

Implications for Bacterial Physiology

The identification of yqhQ as a regulator of fatty acid biosynthesis has significant implications for understanding bacterial metabolism. Fatty acid biosynthesis is an essential process in nearly all bacteria that must be tightly controlled to maintain proper membrane composition and cell division .

The discovery that yqhQ appears to inhibit ACCase activity provides a new mechanism by which bacteria can regulate the committed step in fatty acid synthesis. This regulatory mechanism may be particularly important for bacteria to adapt to changing environmental conditions or nutrient availability .

Potential Applications and Future Research

The recombinant production of yqhQ protein enables various biochemical and structural studies that may further elucidate its precise mechanism of action. Future research directions might include:

  1. Structural determination of yqhQ, potentially through crystallography or cryo-electron microscopy

  2. Biochemical characterization of the interaction between yqhQ and components of the ACCase complex

  3. Investigation of potential small-molecule modulators of yqhQ activity

  4. Exploration of yqhQ as a potential antibiotic target, given its role in the essential process of fatty acid biosynthesis

  5. Comparative studies across different bacterial species to understand evolutionary adaptations in fatty acid regulation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yqhQ; BSU24490; Uncharacterized protein YqhQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqhQ
Target Protein Sequence
MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL LRLEALSEQNQKPSHNVI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant production of yqhQ protein?

E. coli expression systems are currently the most documented approach for recombinant production of yqhQ protein. Based on available research, His-tagged fusion proteins have been successfully expressed in E. coli . When designing your expression system, consider the following methodological guidelines:

  • Optimize codon usage for E. coli if expressing the full-length protein

  • Consider temperature optimization during induction (typically 16-37°C)

  • Test different induction conditions (IPTG concentration, induction time)

  • Evaluate solubility in different buffer conditions

For researchers considering alternative expression systems, B. subtilis itself could serve as a homologous expression host. This approach might preserve native folding and post-translational modifications. Similar to methodologies used with other B. subtilis proteins, you could design constructs that express the protein either during vegetative growth or as fusions to spore coat proteins like CotB for surface display .

What purification strategies are most effective for recombinant yqhQ protein?

For His-tagged recombinant yqhQ protein, immobilized metal affinity chromatography (IMAC) represents the primary purification strategy. The methodological workflow typically involves:

  • Cell lysis under native or denaturing conditions, depending on protein solubility

  • Binding to Ni-NTA or similar metal affinity resin

  • Washing with increasing imidazole concentrations to remove non-specific binding

  • Elution with high imidazole buffer (typically 250-500 mM)

  • Buffer exchange to remove imidazole

For improved purity, consider implementing a secondary purification step such as:

  • Size exclusion chromatography to separate monomeric from aggregated forms

  • Ion exchange chromatography based on the protein's theoretical pI

  • Hydrophobic interaction chromatography if the protein exhibits hydrophobic patches

When evaluating purification success, SDS-PAGE analysis should demonstrate purity greater than 90% as is typical for research-grade recombinant proteins .

How should researchers design experiments to investigate potential functions of yqhQ?

When designing experiments to elucidate the function of uncharacterized proteins like yqhQ, consider implementing a multi-faceted experimental research design that addresses multiple hypotheses simultaneously. Based on experimental research design principles, the following methodological approach is recommended :

  • Sequence-Based Functional Prediction:

    • Conduct thorough bioinformatic analysis including sequence alignment with characterized proteins

    • Identify conserved domains, motifs, and potential functional sites

    • Use this information to generate testable hypotheses about function

  • Structural Analysis:

    • If crystal structure is unavailable, consider techniques like circular dichroism, small-angle X-ray scattering, or computational structure prediction

    • Compare predicted structural elements with those of YqgQ, which has been characterized as a three-helical bundle with potential nucleic acid binding properties

  • Interaction Studies:

    • Design pull-down assays using the His-tagged protein to identify potential binding partners

    • Consider yeast two-hybrid, co-immunoprecipitation, or cross-linking approaches

    • Validate interactions using multiple orthogonal methods

  • Gene Knockout/Knockdown Experiments:

    • Generate B. subtilis strains with yqhQ deletions or controlled expression

    • Assess phenotypes under various growth conditions

    • Perform transcriptomic or proteomic analyses to identify affected pathways

When implementing this experimental design, ensure appropriate controls are included and consider time as a factor in establishing cause-effect relationships .

What approaches should be used to analyze potential nucleic acid binding properties of yqhQ?

Based on structural comparison with related proteins like YqgQ, which shows similarities to proteins involved in RNA transactions, yqhQ may potentially interact with nucleic acids . To investigate this possibility systematically:

  • Electrophoretic Mobility Shift Assays (EMSA):

    • Test binding to different nucleic acid species (ssDNA, dsDNA, RNA)

    • Vary nucleic acid sequence to identify potential sequence preferences

    • Include competition assays with unlabeled nucleic acids to assess specificity

  • Fluorescence Anisotropy:

    • Use fluorescently labeled nucleic acids to quantitatively measure binding kinetics

    • Determine KD values under different buffer conditions

    • Assess the impact of salt concentration on binding (to distinguish specific vs. non-specific interactions)

  • Surface Plasmon Resonance:

    • Immobilize either the protein or nucleic acids

    • Measure real-time binding kinetics

    • Determine association and dissociation rates

  • Structural Analysis of Complexes:

    • Consider nuclear magnetic resonance (NMR) for small fragments

    • X-ray crystallography for full complexes

    • Cryo-electron microscopy for larger assemblies

Data analysis should include careful statistical evaluation of binding measurements, ideally presented in publication-quality figures with error bars and significance indicators as would be expected in research journal articles5.

How can researchers integrate structural and functional data to develop comprehensive models of yqhQ's role in Bacillus subtilis?

Developing integrated models of protein function requires synthesizing diverse experimental datasets. For yqhQ, consider the following methodological framework:

  • Structure-Function Correlation:

    • Map conserved residues onto structural models

    • Perform site-directed mutagenesis of key residues (particularly Arg and Lys residues that might be involved in nucleic acid binding)

    • Assess the impact of mutations on both structure (using biophysical methods) and function (using activity assays)

  • Contextual Analysis:

    • Analyze the genomic context of yqhQ (neighboring genes, operon structure)

    • Determine expression patterns under different growth conditions

    • Integrate with available transcriptomic/proteomic datasets for B. subtilis

  • Evolutionary Analysis:

    • Perform phylogenetic analysis of yqhQ homologs

    • Identify co-evolving proteins that might function in the same pathway

    • Compare conservation patterns across different bacterial species

  • Systems Biology Approach:

    • Integrate yqhQ into existing models of B. subtilis cellular processes

    • Develop testable predictions about system-wide effects of yqhQ perturbation

    • Validate predictions experimentally

When analyzing relationships between experimental results, critically evaluate apparent contradictions, as these often provide valuable insights into complex biological functions and mechanisms5.

What quality control measures should be implemented when working with recombinant yqhQ protein?

Quality control is essential when working with recombinant proteins to ensure experimental reproducibility. For yqhQ research, implement the following methodological quality controls:

  • Expression Verification:

    • Western blot analysis using anti-His antibodies

    • Mass spectrometry confirmation of protein identity

    • N-terminal sequencing of purified protein

  • Purity Assessment:

    • SDS-PAGE with densitometry (aim for >90% purity)

    • Size exclusion chromatography to detect aggregates

    • Endotoxin testing if the protein will be used in immunological studies

  • Structural Integrity:

    • Circular dichroism to verify secondary structure content

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate stability

  • Functional Verification:

    • Develop at least one reproducible functional assay

    • Include positive and negative controls

    • Establish quantitative parameters for activity

Document all quality control data meticulously, including experimental conditions, to enable proper interpretation of subsequent functional studies and to facilitate troubleshooting if inconsistencies arise.

What are the key considerations for designing experiments to investigate yqhQ interactions with other cellular components?

When designing interaction studies for yqhQ, consider both the technical approach and biological context:

  • In Vitro Interaction Studies:

    • Use purified recombinant yqhQ protein as bait

    • Consider both targeted (candidate interactors) and untargeted (proteome-wide) approaches

    • Validate initial hits with multiple orthogonal methods

  • In Vivo Approaches:

    • Tagged versions of yqhQ expressed in B. subtilis

    • Proximity labeling approaches (BioID, APEX)

    • Live-cell imaging if fluorescent protein fusions maintain function

  • Control Considerations:

    • Include tag-only controls to identify non-specific interactions

    • Consider both positive and negative controls appropriate to each method

    • Use scrambled or mutated versions of yqhQ as specificity controls

  • Data Analysis Framework:

    • Establish clear thresholds for defining significant interactions

    • Apply appropriate statistical methods for analyzing large-scale interaction data

    • Use visualization tools to map interaction networks

The experimental design should incorporate appropriate controls to distinguish true interactions from experimental artifacts, particularly when using affinity-based methods that may be prone to identifying non-specific binding partners .

How should researchers address challenges in functional characterization of uncharacterized proteins like yqhQ?

Uncharacterized proteins present unique challenges that require systematic approaches:

  • Hypothesis Generation Strategy:

    • Start with comparative genomics and structural predictions

    • Leverage information from characterized proteins with similar domains

    • Consider phenotypic changes in knockout strains under various conditions

  • Incremental Characterization Approach:

    • Begin with broad functional categories (e.g., binding vs. enzymatic activity)

    • Progressively narrow the focus based on initial findings

    • Develop specific assays based on refined hypotheses

  • Addressing Negative Results:

    • Document thoroughly all negative findings

    • Consider whether assay conditions might mask activity

    • Expand testing conditions (temperature, pH, cofactors, etc.)

  • Collaborative Strategies:

    • Engage with experts in specific techniques

    • Consider structural biology collaborations

    • Participate in consortium efforts focused on uncharacterized proteins

Experimental ChallengeMethodological SolutionExpected Outcome
Lack of functional predictionsHigh-throughput screening approachesIdentification of conditions where yqhQ activity is detectable
Protein insolubilityFusion tags, solubility enhancers, refolding protocolsIncreased yield of functional protein
Absence of known interacting partnersUnbiased interaction screens in native hostDiscovery of potential biological context
Difficulty establishing phenotypesStress conditions, competitive growth assaysIdentification of subtle growth advantages/disadvantages

When interpreting results, maintain appropriate scientific skepticism while remaining open to unexpected functions that may not align with initial hypotheses based on sequence or structural similarities5.

What emerging technologies might accelerate functional characterization of proteins like yqhQ?

Several cutting-edge technologies show promise for uncharacterized protein research:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination without crystallization

    • Visualization of protein complexes in different functional states

    • Integration with computational modeling for functional insights

  • High-Throughput Phenotyping:

    • Automated growth analysis under thousands of conditions

    • Metabolomic profiling of knockout strains

    • Machine learning approaches to identify subtle phenotypic patterns

  • Genome-Wide Interaction Mapping:

    • CRISPR interference screens to identify genetic interactions

    • Transposon sequencing to map synthetic lethal relationships

    • Systematic double knockout libraries to identify redundant functions

  • Single-Cell Approaches:

    • Single-cell transcriptomics to identify cell-to-cell variability in response to yqhQ deletion

    • Single-molecule imaging to track protein localization and dynamics

    • Microfluidic approaches to monitor cellular responses under changing conditions

When implementing these technologies, researchers should design experiments that generate quantitative data suitable for computational integration, as this may reveal patterns not apparent in individual experiments 5.

What comparative genomic approaches might provide insights into yqhQ function?

Comparative genomics offers powerful tools for understanding uncharacterized proteins:

  • Phylogenetic Profiling:

    • Identify co-occurrence patterns of yqhQ across diverse bacterial species

    • Map presence/absence to specific bacterial lifestyles or environmental niches

    • Identify proteins with similar phylogenetic distributions

  • Genomic Context Analysis:

    • Examine conservation of neighboring genes across species

    • Identify operonic structures containing yqhQ homologs

    • Map gene neighborhood networks to predict functional relationships

  • Sequence Conservation Patterns:

    • Analyze patterns of selective pressure across the protein sequence

    • Identify highly conserved residues as potential functional sites

    • Compare conservation patterns with related protein families

  • Horizontal Gene Transfer Analysis:

    • Assess whether yqhQ shows evidence of horizontal transfer

    • Identify potential acquisition events and their evolutionary timing

    • Correlate with acquisition of other genes or phenotypic capabilities

These approaches should be implemented using rigorous statistical methods to distinguish significant patterns from background variation and should include appropriate controls for phylogenetic bias .

How should researchers integrate findings about yqhQ into broader understanding of bacterial protein function?

The uncharacterized protein yqhQ represents an opportunity to expand our understanding of bacterial protein function through systematic research approaches. When integrating findings into the broader scientific context:

  • Contextual Interpretation:

    • Place discoveries within existing knowledge frameworks

    • Identify similarities and differences with better-characterized systems

    • Consider evolutionary implications of functional assignments

  • Model Development:

    • Formulate testable models that explain observed data

    • Update models iteratively as new evidence emerges

    • Consider alternative interpretations that might explain the same observations

  • Knowledge Dissemination:

    • Publish findings in appropriate scientific journals

    • Deposit structural data in public repositories

    • Update database annotations to reflect new functional insights

  • Collaborative Integration:

    • Engage with researchers studying related proteins or systems

    • Consider how findings might inform studies of homologous proteins in pathogenic organisms

    • Participate in consortium efforts aimed at systematic characterization of uncharacterized proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.