Recombinant Bacillus subtilis Uncharacterized protein yqhR (yqhR)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

YqhR is produced recombinantly in E. coli or B. subtilis expression platforms. Commercial protocols (e.g., GeneBioSystems) outline the following parameters:

ParameterSpecification
Host SystemE. coli (primary) or B. subtilis
Expression VectorCustom plasmids with inducible promoters (e.g., T7 or Pspac)
Purification MethodImmobilized metal affinity chromatography (IMAC) via His-tag
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol
YieldVariable; optimized via codon usage adaptation and fermentation scaling

Strain engineering strategies for B. subtilis, such as protease-deficient variants (e.g., WB800) , enhance stability during secretion .

Potential Functional Roles

While YqhR remains uncharacterized, its structural motifs suggest roles in:

  • Membrane transport: Hydrophobic regions align with solute-binding proteins .

  • Stress response: Homology to B. subtilis proteins induced during stationary phase .

Biotechnological Utility

  • Surface display systems: B. subtilis spore-based platforms (e.g., CotG fusion) could anchor YqhR for vaccine development or enzymatic applications.

  • Metabolic engineering: Integration into B. subtilis chassis strains for synthetic pathways .

Knowledge Gaps

  • No resolved 3D structure or enzymatic activity data.

  • Limited studies on transcriptional regulation (e.g., promoter binding sites or sRNA interactions) .

Comparative Advantages of B. subtilis for YqhR Production

FeatureB. subtilis AdvantagesE. coli Limitations
Secretion EfficiencyHigh (Sec or Tat pathways) Requires periplasmic extraction
Endotoxin ContaminationNone (Gram-positive) Significant (requires removal)
ScalabilityOptimized fermentation protocols Lower protein yields in high-density cultures
Regulatory ComplianceGRAS/QPS status Stricter purification requirements

Future Directions

  1. Functional characterization: Knockout studies to identify phenotypic changes in ΔyqhR strains .

  2. Structural analysis: Cryo-EM or X-ray crystallography to resolve active sites.

  3. Industrial optimization: Fed-batch fermentation trials to maximize yield .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it for you.
Synonyms
yqhR; BSU24480; Uncharacterized protein YqhR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqhR
Target Protein Sequence
MMTSEKDTEQNEELNEKQKPPVSMAGRVAATGFCGGVLWSFVAYIAYLFHFSEISPNMIL QPFVLGEWKKHGLGTVISIILIGVISIGAAFLYFLLLKRLKTMWPGILYGLVLWLLVFFV FNPIFPDVRTVTELTSDTIITTICIYLLYGLFVGYSISFEYNELNSEKLARALGMHRE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What initial approaches should researchers use to characterize the uncharacterized YqhR protein in B. subtilis?

The characterization of uncharacterized proteins like YqhR should begin with a multi-faceted approach similar to strategies used for other B. subtilis proteins:

  • Sequence analysis and computational prediction: Use bioinformatic tools to identify conserved domains, predict structure, and find orthologous proteins in related organisms. This approach was effective for YlxR (renamed RnpM), which was identified as widely conserved in bacteria, suggesting an important function .

  • Expression profiling: Determine when and how strongly YqhR is expressed in B. subtilis under different conditions. YlxR/RnpM was found to be strongly constitutively expressed, indicating its potential importance in basic cellular processes .

  • Gene knockout studies: Create YqhR deletion mutants and observe phenotypic changes. This technique has been demonstrated in B. subtilis studies using methods like the Cre/lox system for marker removal after gene deletion .

  • Protein localization: Determine where YqhR is located within the cell using fluorescent protein tagging or cellular fractionation. Similar studies with YhcR showed it was principally located in the cell wall and likely a substrate for a B. subtilis sortase .

How can evolutionary conservation analysis help predict YqhR function?

Evolutionary conservation analysis provides crucial insights into potential functions of uncharacterized proteins:

What expression systems are most suitable for recombinant production of YqhR protein for structural studies?

Based on successful approaches with other B. subtilis proteins:

  • B. subtilis-based expression: Using modified strains of B. subtilis itself can be advantageous for expressing native proteins. The study of recombinant B. subtilis chassis cells demonstrated that modified strains with altered lifespans can increase biomass and protein expression by up to 20% .

  • E. coli expression optimization:

    • BL21(DE3) or derivatives for high-yield expression

    • Codon optimization for E. coli if necessary

    • Expression with fusion tags (His6, MBP, GST) to improve solubility and facilitate purification

    • Testing different induction conditions (temperature, IPTG concentration, induction time)

  • Secretory expression: If YqhR is predicted to be secreted like YhcR, consider expression systems that facilitate secretion into the medium for easier purification .

  • Cell-free expression systems: These can be particularly useful for proteins that might be toxic when expressed in vivo.

What strategies can be employed to identify potential interaction partners of YqhR?

Identifying protein interaction partners is crucial for functional characterization, as demonstrated in studies of YlxR/RnpM:

  • Co-immunoprecipitation coupled with mass spectrometry: This approach can identify proteins that physically interact with YqhR in vivo. YlxR was identified as an interaction partner of RNase P RNA through similar approaches .

  • Bacterial two-hybrid assays: While yeast two-hybrid systems have limitations as noted in human protein interactome studies, modified bacterial two-hybrid systems can be effective for bacterial proteins .

  • Chemical cross-linking strategies: Cross-linking followed by mass spectrometry can capture transient interactions. This technique helped determine that YlxR binds to specific regions of RNase P RNA important for substrate binding .

  • In silico docking analysis: Complement experimental data with computational prediction of interaction interfaces. This approach was successfully used to study YlxR binding to RNase P RNA .

  • Proximity-based labeling: Methods like BioID or APEX can identify proteins in close proximity to YqhR in vivo, providing spatial context for potential interactions.

How can RNA-seq and proteomics data be integrated to elucidate the function of YqhR?

Multi-omics integration provides comprehensive insights into protein function:

  • Differential expression analysis: Compare transcriptome and proteome profiles between wild-type and YqhR knockout strains to identify pathways affected by YqhR absence.

  • Time-course experiments: Analyze changes in gene expression and protein levels over time after YqhR induction or depletion to distinguish direct from indirect effects.

  • Condition-specific profiling: Examine expression patterns under different stress conditions to identify when YqhR function becomes critical.

  • Integration algorithms: Use computational approaches to correlate RNA-seq, proteomics, and phenotypic data. Network analysis can reveal functional associations even when direct interactions are not detected.

  • Validation experiments: Confirm key findings from omics data with targeted experiments, such as quantitative RT-PCR or Western blotting.

What approaches can resolve contradictory data regarding YqhR subcellular localization?

Resolving contradictory localization data requires systematic analysis:

  • Multiple tagging strategies: Use different protein tags (e.g., GFP, mCherry) at both N- and C-termini to ensure tag interference isn't causing artifacts. Studies of YhcR showed it was primarily located in the cell wall, which influenced understanding of its function .

  • Cellular fractionation with controls: Separate cellular compartments biochemically and track marker proteins for each compartment alongside YqhR detection.

  • Immunogold electron microscopy: Provides high-resolution localization data that can clarify conflicting results from fluorescence microscopy.

  • Functional validation of localization: Design experiments where YqhR is artificially directed to different cellular compartments to determine where it must be located to function.

  • Context-dependent localization: Examine whether YqhR changes location under different growth conditions or developmental stages.

What controls are essential when designing knockout studies for YqhR functional characterization?

Proper controls are critical for accurate interpretation of knockout phenotypes:

  • Complementation controls: Re-introduce YqhR expression to confirm phenotypes are specifically due to YqhR absence. The knockout methods described for B. subtilis using the Cre/lox system provide a framework for these studies .

  • Multiple independent knockout strains: Generate several independent knockout strains to ensure observed phenotypes aren't due to secondary mutations.

  • Conditional knockout systems: For essential genes, use inducible expression systems to control protein levels rather than complete deletion.

  • Controls for polar effects: Ensure knockout doesn't affect expression of downstream genes in the same operon.

  • Growth condition variation: Test knockouts under diverse conditions (minimal media, different carbon sources, stress conditions) to reveal condition-specific functions.

What enzymatic assays would be appropriate for initial biochemical characterization of YqhR?

Based on approaches used for other B. subtilis proteins:

  • General activity screens: Test for common enzymatic activities (nuclease, protease, kinase, phosphatase) using broad-spectrum substrates.

  • Activity-guided fractionation: Fractionate B. subtilis extracts based on specific activities of interest while tracking YqhR by western blot or activity assays. This approach helped characterize YhcR as a sugar-nonspecific nuclease .

  • Metal ion dependence: Test activity in the presence of different metal ions. YhcR showed activity in the presence of Ca²⁺ and Mn²⁺, which provided clues to its function .

  • Substrate specificity determination: Once a general activity is identified, test a range of substrates to determine specificity. YhcR was shown to cleave endonucleolytically to yield nucleotide 3′-monophosphate products .

  • Kinetic parameter measurement: Determine Km, Vmax, and inhibition patterns to characterize enzymatic behavior.

How should researchers design site-directed mutagenesis experiments to probe YqhR function?

Strategic mutagenesis can reveal functional mechanisms:

  • Conservation-guided approach: Target highly conserved residues first, as these are most likely to be functionally important.

  • Structure-informed design: If structural information or reliable models are available, focus on residues in predicted active sites or interaction interfaces.

  • Systematic domain analysis: Create truncation mutants to test the contribution of different protein domains to function.

  • Charge reversal mutations: Change charged residues to opposite charges to disrupt potential electrostatic interactions. This approach was used successfully in YlxR studies to understand interaction with RNase P RNA .

  • Activity-dead controls: Include mutations known to abolish activity completely as controls in functional assays.

How can researchers resolve ambiguities in phenotype assignment when studying YqhR?

Resolving phenotypic ambiguities requires:

  • Quantitative phenotyping: Use quantitative rather than qualitative measures of phenotypes to detect subtle effects.

  • Comparison to related gene knockouts: Study phenotypes of knockouts in genes potentially related to YqhR to identify patterns. The comparative analysis of multiple autolysis genes in B. subtilis demonstrates this approach .

  • Suppressor screens: Identify mutations that suppress the YqhR knockout phenotype to reveal functional pathways.

  • Genetic interaction mapping: Systematically combine YqhR knockout with other knockouts to identify synthetic lethality or rescue effects.

  • Environmental modulation: Test how environmental factors influence the penetrance or expressivity of phenotypes to understand context-dependence of function.

What statistical approaches are recommended for analyzing large-scale interaction data involving YqhR?

For robust analysis of interaction datasets:

How can researchers differentiate between direct and indirect effects when characterizing YqhR function?

Distinguishing direct from indirect effects requires:

  • In vitro reconstitution: Purify YqhR and potential interacting partners to test whether observed effects can be reconstituted with purified components. Studies with YlxR demonstrated its direct effect on RNase P activity through in vitro processing assays .

  • Temporal resolution: Use time-course experiments with high temporal resolution to identify the earliest effects after YqhR perturbation.

  • Dose-response relationships: Examine how effects scale with YqhR concentration or activity to identify thresholds consistent with direct effects.

  • Chemical-genetic approaches: Use small molecule inhibitors or activators to rapidly modulate YqhR activity and observe immediate consequences.

  • Proximity labeling: Use techniques like BioID to identify proteins in close physical proximity to YqhR in vivo.

What approaches can determine if YqhR has moonlighting functions in different cellular contexts?

For identifying moonlighting functions:

  • Condition-specific localization: Track YqhR localization under different growth conditions to detect redistribution that might indicate context-specific functions.

  • Interactome comparison: Compare YqhR interaction partners identified under different conditions to detect condition-specific interactions.

  • Domain-specific mutations: Design mutations that affect specific domains to determine if different functions can be separated genetically.

  • Cross-species complementation: Test whether YqhR can complement phenotypes of mutations in apparently unrelated genes in other organisms.

  • Post-translational modification mapping: Identify condition-specific modifications that might regulate different functions of YqhR.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.