Recombinant Bacillus subtilis Uncharacterized protein yqxH (yqxH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqxH; yqdD; BSU25910; Uncharacterized protein YqxH; ORF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqxH
Target Protein Sequence
MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKAWKFKKLRSRSAWFGY VRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITENLAQIGVKIPSSITDR LQTIENEKEQSKNNADKAAG
Uniprot No.

Target Background

Database Links
Protein Families
Cp-1 holin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What structural features are predicted for yqxH protein?

Computational analysis of yqxH suggests:

Structural FeaturePredictionConfidence Score
Transmembrane domains3-4 potential regionsHigh
Secondary structure42% α-helix, 18% β-sheet, 40% random coilMedium
Functional domainsNo recognized domain signatures in Pfam/PROSITE-
Subcellular localizationMembrane-associatedHigh

The high proportion of hydrophobic residues (notably the stretch "LLLVLSIIDVLTGVIK") strongly suggests membrane association, which may provide clues about its potential role in cellular processes . Advanced structural prediction algorithms indicate the protein likely adopts a membrane-spanning conformation with cytoplasmic and extracellular domains.

How should recombinant yqxH protein be handled in laboratory settings?

Optimal storage conditions for recombinant yqxH protein include:

  • Storage at -20°C for short-term use, or -80°C for extended storage

  • Formulation in Tris-based buffer with 50% glycerol (optimized for this specific protein)

  • Avoiding repeated freeze-thaw cycles, which can compromise protein integrity

  • Maintaining working aliquots at 4°C for up to one week

For experimental applications, preliminary testing suggests that yqxH retains stability in standard biochemical buffers (PBS, HEPES) at physiological pH (7.2-7.4) for several hours at room temperature, though activity assays remain to be standardized due to its uncharacterized nature.

What analytical techniques are most effective for characterizing uncharacterized proteins like yqxH?

A multi-technique approach is recommended for comprehensive characterization:

TechniqueApplicationExpected Insights
Mass SpectrometryPost-translational modifications, interaction partnersPTM mapping, protein complexes
Circular DichroismSecondary structure compositionConfirmation of α-helix/β-sheet predictions
Crystallography/Cryo-EM3D structure determinationStructural homology to known proteins
ELISABinding studies, antibody developmentInteraction specificity and affinity
NMR SpectroscopyDynamic structural analysisConformational changes under different conditions

For membrane proteins like yqxH, techniques such as hydrophobic interaction chromatography and detergent solubilization optimization are critical preliminary steps. Researchers should prioritize structural studies in native-like membrane environments (e.g., nanodiscs or liposomes) to maintain physiologically relevant conformations.

How can transcriptomics and proteomics approaches be applied to study yqxH function?

Integrated -omics approaches can provide significant insights into yqxH function:

  • RNA-Seq analysis: Compare gene expression patterns between wild-type and yqxH knockout strains under various conditions to identify co-regulated genes. Similar approaches have been successful with other uncharacterized B. subtilis proteins (as seen with yqjI) .

  • Quantitative proteomics: Stable isotope labeling (SILAC) or isobaric tagging (TMT/iTRAQ) can identify proteins with altered abundance in yqxH mutants, suggesting potential pathways affected.

  • Protein-protein interaction studies: Proximity labeling techniques (BioID/APEX) or co-immunoprecipitation coupled with mass spectrometry can identify interaction partners of yqxH, providing functional context.

  • Metabolomics profiling: Comparing metabolite profiles between wild-type and yqxH-deficient strains can reveal affected metabolic pathways, as demonstrated in studies of other B. subtilis proteins .

These approaches should be applied systematically, starting with transcriptome analysis under different growth conditions to identify conditions where yqxH is maximally expressed.

What computational approaches can predict potential functions of yqxH?

Contemporary computational approaches for functional prediction include:

ApproachMethodologyLimitations
Homology-based function predictionSequence similarity to characterized proteinsLimited by availability of characterized homologs
Structural homology modelingThreading of sequence onto known structuresAccuracy depends on template quality
Genomic context analysisExamining neighboring genes and operonsMay not apply to horizontally transferred genes
Protein-protein interaction network analysisIntegration into known interaction networksRequires experimental validation
Machine learning approachesFeature extraction from multiple propertiesHeavily dependent on training dataset quality

For yqxH specifically, analysis using BSubCyc database resources can position the protein within the broader metabolic and regulatory networks of B. subtilis . Comparative genomic analysis across the >60 B. subtilis strains in the BioCyc collection can identify patterns of conservation that suggest functional importance.

How can gene knockout studies help determine the function of yqxH?

Systematic knockout analysis provides a foundational approach to characterizing uncharacterized proteins:

  • Generation of clean deletion mutants: CRISPR-Cas9 or traditional homologous recombination approaches can generate precise yqxH deletion strains.

  • Phenotypic characterization:

    • Growth kinetics under various conditions (carbon sources, stress conditions)

    • Morphological analysis (cell shape, biofilm formation)

    • Metabolic profiling (similar to approaches used with yqjI)

  • Complementation studies: Reintroduction of yqxH under native or inducible promoters to confirm phenotype rescue.

  • Conditional knockouts: When complete deletion is lethal, controlled expression systems can reveal essential functions.

This systematic approach has proven successful for characterizing other previously uncharacterized B. subtilis proteins. For example, research on yqjI revealed its role as the predominant NADP+-dependent 6-P-gluconate dehydrogenase in the oxidative pentose phosphate pathway, despite previous assumptions about a different protein (GntZ) playing this role .

What experimental design would best identify the conditions under which yqxH is expressed?

A comprehensive expression profiling strategy would include:

Experimental ConditionMethodologyExpected Outcome
Growth phase variationqRT-PCR and western blotting at different growth stagesTemporal expression pattern
Nutrient limitationMinimal media with various carbon/nitrogen sourcesNutrient-dependent regulation
Stress conditionsHeat, oxidative, osmotic, antibiotic stressesStress-responsive expression
Environmental variationpH, temperature, oxygen availabilityEnvironmental sensitivity
Genetic backgroundExpression in regulatory mutantsRegulatory network positioning

Implementation of reporter constructs (yqxH promoter fused to fluorescent proteins or luciferase) can facilitate high-throughput screening across multiple conditions. Quasi-experimental designs, as described in research methodology literature, can be particularly valuable for systematically testing multiple variables while maintaining experimental control .

How does yqxH relate to other characterized proteins in Bacillus subtilis?

While direct relationships between yqxH and other B. subtilis proteins are not fully established, systematic approaches to position it within the cellular network include:

  • Co-expression analysis: Identifying genes with similar expression patterns across various conditions using publicly available transcriptomic datasets.

  • Protein interaction studies: Yeast two-hybrid, pull-down assays, or cross-linking mass spectrometry to identify direct interactors.

  • Synthetic genetic arrays: Systematic genetic interaction mapping to identify genes with synergistic or antagonistic relationships with yqxH.

  • Comparative functional genomics: Leveraging knowledge from BSubCyc and other databases to identify proteins with similar genomic context or phylogenetic profiles .

The regulatory networks of B. subtilis, as documented in BSubCyc, provide a framework for understanding how yqxH might be integrated into known cellular processes .

How conserved is yqxH across different Bacillus subtilis strains and related species?

Comparative genomic analysis reveals interesting patterns in yqxH conservation:

Taxonomic GroupConservation LevelNotes
B. subtilis strains>95% sequence identityCore genome component
Bacillus genusModerate conservation (60-80%)Present in most Bacillus species
Bacillales orderLow-moderate conservation (30-60%)Patchy distribution
Other FirmicutesLow conservation (<30%)Limited to specific lineages
Other bacterial phylaNot detectedLikely Firmicutes-specific

This conservation pattern suggests yqxH emerged early in Bacillus evolution and has been maintained, indicating functional importance despite its uncharacterized status. The observation that it belongs to the core genome component of B. subtilis suggests it likely performs a fundamental cellular function rather than a specialized niche adaptation.

What can phylogenetic analysis reveal about yqxH evolution?

Phylogenetic analysis of yqxH and its homologs can provide insights into:

  • Evolutionary history: Mapping the emergence and diversification of yqxH across bacterial lineages.

  • Selection patterns: Calculating dN/dS ratios to identify regions under purifying or positive selection.

  • Domain evolution: Tracing the acquisition or loss of functional domains over evolutionary time.

  • Horizontal gene transfer: Identifying potential instances of lateral acquisition through phylogenetic incongruence.

This approach has been successfully applied to other B. subtilis proteins, such as the 6-P-gluconate dehydrogenase family, which revealed three distinct classes with different evolutionary origins and functions (YqjI, GntZ, and YqeC) .

What are the main challenges in determining the function of uncharacterized proteins like yqxH?

Researchers face several significant challenges when working with uncharacterized proteins:

  • Lack of obvious phenotypes: Single gene deletions often show no detectable phenotype due to genetic redundancy or condition-specific functions, requiring sophisticated screening approaches.

  • Membrane protein challenges: If yqxH is indeed membrane-associated as predicted, this presents additional technical difficulties in expression, purification, and structural studies.

  • Condition-specific functions: The protein may only be functionally important under specific conditions not routinely tested in laboratory settings.

  • Technological limitations: Current methods may be insufficient to detect subtle biochemical activities or transient interactions.

  • Bioinformatic barriers: Limited homology to characterized proteins restricts computational prediction accuracy.

Addressing these challenges requires integrated approaches combining classical genetics, advanced biochemistry, and computational biology methods. The trajectory for quality improvement research described by Campbell et al. provides a useful framework, progressing from concept development through staged experimentation .

How can multi-omics data integration improve functional characterization of yqxH?

Integrated multi-omics approaches provide powerful strategies for functional discovery:

Omics LayerTechnical ApproachIntegration Strategy
GenomicsComparative genomics, synteny analysisIdentify conserved genetic contexts
TranscriptomicsRNA-Seq, microarraysMap co-expression networks
ProteomicsMS-based quantitative proteomicsIdentify protein abundance changes
MetabolomicsLC-MS or NMR-based profilingDetect metabolic shifts
InteractomicsAP-MS, BioID, Y2HMap protein interaction networks
Fluxomics13C-labeling experimentsQuantify metabolic pathway usage

The successful integration of these data types requires sophisticated computational approaches, including network analysis, machine learning algorithms, and statistical modeling. This multi-layered approach has been successfully applied to other initially uncharacterized B. subtilis proteins, as demonstrated in research on the oxidative pentose phosphate pathway enzymes .

What experimental validation approaches are most convincing for proposed yqxH functions?

Robust functional validation requires multiple lines of evidence:

  • Biochemical activity assays: Direct demonstration of enzymatic activity or binding properties.

  • In vivo genetic complementation: Rescue of knockout phenotypes by wild-type but not mutated versions of the gene.

  • Structure-function relationship studies: Targeted mutagenesis of predicted functional residues to correlate structure with activity.

  • Heterologous expression studies: Confirming function in different genetic backgrounds.

  • In vitro reconstitution experiments: Rebuilding the proposed biological process with purified components.

The gold standard for validation combines in vitro biochemical characterization with in vivo functional demonstration, as exemplified by the comprehensive characterization of YqjI (GndA) as the principal 6-P-gluconate dehydrogenase in B. subtilis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.