Recombinant Bacillus subtilis Uncharacterized protein yqxM (yqxM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance; additional charges will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize developing your specified tag.

Synonyms
tapA; yqhD; yqxM; BSU24640; TasA anchoring/assembly protein; Biofilm assembly accessory protein TapA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqxM
Target Protein Sequence
MFRLFHNQQKAKTKLKVLLIFQLSVIFSLTAAICLQFSDDTSAAFHDIETFDVSLQTCKD FQHTDKNCHYDKRWDQSDLHISDQTDTKGTVCSPFALFAVLENTGEKLKKSKWKWELHKL ENARKPLKDGNVIEKGFVSNQIGDSLYKIETKKKMKPGIYAFKVYKPAGYPANGSTFEWS EPMRLAKCDEKPTVPKKETKSDVKKENETTQKDIPEKTMKEETSQEAVTKEKETQSDQKE SGEEDEKSNEADQ
Uniprot No.

Target Background

Function

This protein is essential for biofilm formation. It plays a crucial role in the proper anchoring and polymerization of TasA amyloid fibers on the cell surface and is also a minor component of these fibers.

Gene References Into Functions
  1. TapA (YqxM) is essential for the proper anchoring and assembly of TasA amyloid fibers. PMID: 21477127
Database Links
Subcellular Location
Secreted, cell wall. Secreted.

Q&A

What is YqxM and what is its genomic context in Bacillus subtilis?

YqxM is an uncharacterized protein encoded by the yqxM gene in Bacillus subtilis. It resides in an operon with sipW (which encodes a signal peptidase) and tasA (which encodes an antibiotic protein secreted in a sipW-dependent manner). The genomic organization suggests functional relationships between these three proteins, with SipW likely processing both YqxM and TasA for secretion. The operon is expressed during early-stationary-phase growth, suggesting a role in stress response or adaptation to changing environmental conditions .

What is the molecular weight of YqxM and why does it show discrepancies in gel migration patterns?

YqxM exhibits interesting discrepancies between its predicted and observed molecular weights:

ConditionApparent Molecular WeightNotes
Predicted from sequence24.5 kDaBased on amino acid composition
E. coli expression38 kDaOverproduced in heterologous system
High salt growth in B. subtilis38 kDaSecreted form in culture supernatant
Pspac promoter expression30 kDaIn both cell extracts and supernatants
After SipW processingReduced by ~8 kDaDue to signal peptide cleavage

These discrepancies likely result from post-translational modifications, the presence of a signal peptide (which is cleaved during secretion), and possibly protein-folding characteristics that affect migration in SDS-PAGE .

Under what conditions is YqxM naturally expressed?

YqxM expression is highly condition-dependent. The protein is:

  • Undetectable during growth in standard rich media (including Luria-Bertani)

  • Undetectable in minimal media

  • Not induced by heat shock or ethanol stress conditions

  • Synthesized and secreted during growth in LB medium supplemented with 1.2 M NaCl

  • Detectable approximately 1 hour prior to stationary phase when induced by high salt

  • Present for at least 4 hours after initial detection in high salt conditions

These findings indicate that YqxM production is specifically induced by high osmotic stress conditions, suggesting a potential role in the bacterial osmotic stress response .

How can I experimentally induce YqxM expression in laboratory settings?

There are two primary approaches to inducing YqxM expression:

  • High salt induction: Grow B. subtilis in LB medium supplemented with 0.65-1.2 M NaCl. YqxM becomes detectable in culture supernatants approximately 1 hour before stationary phase.

  • Promoter replacement: Replace the native promoter with an inducible promoter such as Pspac. This can be achieved by:

    • Creating a DNA fragment containing the yqxM open reading frame

    • Ligating this fragment into a plasmid with the Pspac promoter

    • Introducing the construct into the B. subtilis genome via Campbell-type single reciprocal integration

    • Inducing expression with IPTG (isopropyl-β-d-thiogalactopyranoside)

When using promoter replacement, YqxM can be detected in both cell extracts and culture supernatants, unlike the native expression system where it's primarily found in supernatants .

What evidence suggests YqxM is involved in biofilm formation?

Multiple lines of evidence support YqxM's role in biofilm formation:

  • Mutants with defective yqxM show impaired pellicle formation and abnormal colony morphology

  • The yqxM operon (including sipW and tasA) is implicated in the production of extracellular matrix components

  • Expression of the yqxM gene (as measured by fluorescent reporters like PyqxM-CFP) shows spatial localization during biofilm development, with higher expression at biofilm edges

  • Regulatory mutants (Δspo0A and ΔabrB) that affect biofilm formation also significantly alter yqxM expression levels

These findings collectively indicate that YqxM is a structural component of the extracellular matrix that holds B. subtilis biofilms together .

How does YqxM interact with other biofilm matrix components?

YqxM works in concert with other components to form the extracellular matrix of B. subtilis biofilms:

  • The protein component of the biofilm matrix is encoded by the yqxM operon

  • The polysaccharide component is encoded by the eps operon

  • Some strains also utilize γ-polyglutamate as an additional matrix component

In biofilm formation, YqxM-producing cells typically grow in long chains that are held together in parallel alignment by the extracellular matrix. Mutants lacking functional YqxM form floating aggregates of relatively short chains of cells that fail to properly colonize surfaces. This suggests that YqxM helps mediate cell-cell interactions and structural integrity within the biofilm .

What methods can be used to detect and quantify YqxM expression?

Several techniques can be employed to study YqxM expression:

  • Western blotting: Using anti-YqxM antibodies to detect the protein in cell extracts and culture supernatants. Antibodies can be generated by:

    • Amplifying a fragment of the yqxM coding region

    • Expressing the fragment in E. coli with a 6×His tag

    • Purifying the recombinant protein using nickel chromatography

    • Immunizing rabbits with the purified protein

  • Fluorescent reporters: Creating transcriptional fusions of the yqxM promoter with fluorescent proteins (e.g., PyqxM-CFP) to visualize gene expression in living cells

  • MALDI Mass Spectrometry Imaging (MSI): For spatial analysis of protein distribution within biofilms

  • RT-PCR or RNA-seq: To measure yqxM transcript levels under different conditions .

How can I create and verify yqxM mutants in B. subtilis?

To create and verify yqxM mutants:

  • Deletion mutant construction:

    • Use long-flanking-homology PCR strategy to replace the yqxM gene with an antibiotic resistance marker

    • Introduce the deletion allele into B. subtilis strain 3610 by SPP1 phage transduction

  • Complementation analysis:

    • Amplify a wild-type copy of the deleted gene using PCR

    • Clone the gene into an appropriate vector with its native promoter or an inducible promoter

    • Integrate the construct into the mutant strain

    • Verify restoration of the wild-type phenotype

  • Phenotypic verification:

    • Assess pellicle formation by inoculating MSgg medium and incubating at 30°C for 60 hours

    • Evaluate colony morphology on solid media

    • Use phase-contrast microscopy to observe cellular arrangements in biofilms

  • Molecular verification:

    • PCR analysis to confirm gene deletion

    • Western blotting to verify absence of YqxM protein .

How does the SipW signal peptidase process YqxM, and what experimental approaches can distinguish between processed and unprocessed forms?

SipW processing of YqxM can be studied through several experimental approaches:

  • Heterologous co-expression system:

    • Express yqxM alone or with sipW in E. coli

    • Compare the molecular weights by SDS-PAGE and Western blotting

    • A decrease in apparent molecular mass (approx. 8 kDa) when co-expressed with SipW indicates signal peptide processing

  • Site-directed mutagenesis:

    • Mutate the predicted signal peptide cleavage site

    • Express the mutant protein and assess SipW-dependent processing

    • Compare localization and function to wild-type protein

  • N-terminal sequencing:

    • Purify secreted YqxM from culture supernatants

    • Determine the N-terminal sequence to identify the exact cleavage site

    • Compare with bioinformatic predictions of signal peptide structure

When designing these experiments, researchers should account for the unusual migration pattern of YqxM in SDS-PAGE, which may complicate interpretation of results .

What experimental design would best elucidate the molecular mechanisms of YqxM's posttranscriptional regulation?

To investigate YqxM's posttranscriptional regulation, a comprehensive experimental design should include:

  • Transcript analysis:

    • Quantitative RT-PCR to measure yqxM mRNA levels under various conditions

    • Northern blot analysis to assess transcript stability and processing

    • RNA-seq to identify potential regulatory RNAs

  • Translational efficiency:

    • Construct translational fusions of yqxM with reporter genes (e.g., lacZ, gfp)

    • Compare transcriptional versus translational reporter activity

    • Mutagenize the 5' UTR to identify regulatory elements

  • RNA structure analysis:

    • In vitro structure probing of the yqxM mRNA

    • SHAPE (Selective 2'-hydroxyl acylation analyzed by primer extension) analysis

    • Identification of potential riboswitch elements responsive to salt concentration

  • Protein-RNA interactions:

    • RNA immunoprecipitation to identify proteins binding to yqxM mRNA

    • In vitro binding assays with candidate RNA-binding proteins

    • CLIP-seq (crosslinking immunoprecipitation-sequencing) to map binding sites

This multi-faceted approach would help distinguish between mRNA stability effects, translational regulation, and potential regulatory RNA interactions .

How can quasi-experimental designs be applied to study YqxM function in complex natural environments?

Quasi-experimental approaches can bridge laboratory findings and environmental relevance:

  • Field sampling strategies:

    • Collect soil and plant samples from environments with varying salinity

    • Extract DNA/RNA and use qPCR to quantify yqxM expression

    • Correlate expression with environmental parameters

  • Microcosm experiments:

    • Design soil microcosms with controlled gradients of salt concentration

    • Introduce wild-type and yqxM mutant strains

    • Monitor population dynamics and spatial distribution

  • Time-series interrupted designs:

    • Establish stable biofilms in flow cells or soil columns

    • Introduce salt stress interventions at defined timepoints

    • Monitor changes in biofilm architecture and yqxM expression

  • Comparative ecological studies:

    • Survey yqxM homologs across Bacillus species from diverse habitats

    • Correlate sequence variation with ecological niches

    • Use phylogenetic analyses to infer evolutionary trajectories

These approaches allow researchers to study YqxM function when randomized experimental control is impractical or impossible in complex natural systems .

What experimental considerations are important when using YqxM as a protein carrier for recombinant expression in B. subtilis?

When using YqxM as a protein carrier for recombinant expression, consider:

  • Expression system design:

    ApproachAdvantagesLimitations
    Native promoter + salt inductionPhysiological regulationLimited to high salt conditions
    Pspac inducible promoterControl over expression timingRequires IPTG addition
    Spore coat fusion (CotB-YqxM)Surface display applicationsLimited to sporulation phase
  • Fusion protein considerations:

    • Optimal fusion points (N-terminal vs. C-terminal)

    • Inclusion of flexible linker sequences

    • Preservation of signal peptide for secretion

    • Potential effects on SipW processing

  • Purification strategies:

    • Addition of affinity tags (His6, GST) for purification

    • Impact of salt concentration on protein stability and purification

    • Optimization of cultivation conditions

  • Validation methods:

    • Western blotting to confirm expression and processing

    • Activity assays for the fusion partner

    • Mass spectrometry to verify correct processing

Researchers should carefully consider whether to target expression in vegetative cells, on spore surfaces, or both, depending on the specific application requirements .

How can advanced experimental designs help resolve contradictory findings about YqxM's molecular weight and processing?

To resolve contradictions regarding YqxM's molecular weight and processing:

  • Comprehensive comparative analysis:

    • Express YqxM in multiple systems under identical conditions

    • Analyze by multiple gel systems (varying acrylamide percentages)

    • Include precise molecular weight standards

    • Perform mass spectrometry analysis of purified protein

  • Post-translational modification mapping:

    • Phosphoproteomic analysis

    • Glycosylation profiling

    • Other potential modifications affecting migration

    • Site-directed mutagenesis of putative modification sites

  • Structural analysis approaches:

    • Limited proteolysis combined with mass spectrometry

    • Hydrogen-deuterium exchange

    • Circular dichroism to assess secondary structure

    • Biophysical characterization under different salt conditions

  • Advanced microscopy techniques:

    • FRET analysis of YqxM interactions with SipW and TasA

    • Super-resolution microscopy to localize YqxM within cells

    • Correlative light and electron microscopy to visualize secretion

These methodological approaches can help reconcile the observed discrepancies between predicted and apparent molecular weights, providing insights into YqxM processing and potential structural transitions .

What experimental strategies could elucidate YqxM's specific role in osmotic stress response?

To determine YqxM's role in osmotic stress response:

  • Comparative physiological analysis:

    • Growth curves of wild-type vs. yqxM mutants under various salt concentrations

    • Measurement of membrane integrity under osmotic shock

    • Determination of cellular turgor pressure and cell shape changes

    • Analysis of compatible solute accumulation

  • Transcriptomic and proteomic approach:

    • RNA-seq comparison of wild-type and yqxM mutants during salt stress

    • Proteomic analysis of membrane and secreted fractions

    • Phosphoproteomics to identify signaling pathways affected

    • Temporal analysis of the stress response

  • Localization studies:

    • Fluorescently tagged YqxM to track localization during osmotic stress

    • Immunogold electron microscopy to determine subcellular localization

    • FRET/BRET analysis to identify interaction partners during stress

  • Structural biology approach:

    • Structural characterization of YqxM under varying salt concentrations

    • Analysis of conformational changes in response to ionic environment

    • Identification of potential ion-binding sites

These multidisciplinary approaches would help determine whether YqxM plays a structural, signaling, or enzymatic role in the osmotic stress response pathway .

How might high-throughput experimental designs help identify the full spectrum of conditions affecting YqxM expression?

High-throughput approaches to characterize YqxM expression:

  • Microfluidic cultivation systems:

    • Parallel cultivation under hundreds of different conditions

    • Real-time monitoring of fluorescent reporters (PyqxM-GFP)

    • Single-cell analysis of expression heterogeneity

    • Combination of multiple stressors in gradient matrices

  • Robotic screening platforms:

    • Automated cultivation in 96/384-well formats

    • Systematic variation of media components and stress factors

    • Integrated sampling for transcriptomics and proteomics

    • Machine learning to identify complex expression patterns

  • Biosensor development:

    • Engineer strains with PyqxM driving expression of easily detectable reporters

    • Screen environmental samples for inducing conditions

    • Develop portable biosensors for field applications

    • Multiplexed detection with other stress-responsive promoters

  • Genome-wide interaction studies:

    • Transposon sequencing (Tn-seq) under YqxM-inducing conditions

    • CRISPRi screens to identify genes affecting YqxM expression

    • Synthetic genetic array analysis with yqxM mutants

    • Chemical genomics to identify small molecules affecting expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.