Recombinant Bacillus subtilis Uncharacterized protein yrkK (yrkK)

Shipped with Ice Packs
In Stock

Description

Definition and Context

Recombinant yrkK refers to a heterologously expressed version of the yrkK gene product from B. subtilis strain 168. The protein is designated "uncharacterized" due to the absence of experimentally validated functional data. Its production leverages B. subtilis's well-established secretion systems and GRAS (Generally Recognized as Safe) status, which simplifies regulatory approval for biomedical and industrial applications .

Production and Purification

Recombinant yrkK is typically produced using plasmid-based systems in protease-deficient B. subtilis strains to minimize degradation. Key production parameters include:

  • Vector: Custom plasmids with inducible promoters (e.g., grac212 or subtilin-inducible systems) .

  • Induction: Chemically inducible systems (e.g., IPTG) or autoinduction media .

  • Secretion Pathway: Predominantly Sec-dependent transport, leveraging signal peptides for extracellular export .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Applications and Research Utility

Though uncharacterized, yrkK’s applications are inferred from analogous recombinant proteins in B. subtilis:

  • Enzyme Engineering: Potential substrate for structure-function studies due to hydrophobic domains.

  • Biotechnological Tool: Serve as a scaffold for fusion proteins or bioorthogonal tagging .

  • Industrial Biosynthesis: Compatibility with large-scale bioreactor production .

Challenges and Future Directions

  • Functional Annotation: No experimental data exist on yrkK’s biological role or enzymatic activity.

  • Optimization: Protease activity in B. subtilis may require strain engineering (e.g., genome-reduced strains like IIG-Bs-27-39) .

  • Scalability: Secretion efficiency improvements via Tat pathway engineering could enhance yields .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
yrkK; BSU26480; Uncharacterized protein YrkK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yrkK
Target Protein Sequence
MVYFVAFFCFAITLHNIEEAIWLPEWSQQSSKFQKPVTSNEFHFAVIVITMLAYLSAFGF LYMPESDIAKWIFIGFLGSMVINAIFPHLIATVVMKKYAPGLLTGLLLNIPVNSLVIYQM FLKNLIVWKELIISTLVVGIILLALIPLLFKVGDKVSP
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU26480

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yrkK protein in Bacillus subtilis and what is currently known about its structure?

The yrkK protein in Bacillus subtilis is currently classified as an uncharacterized protein with limited information about its specific function. While comprehensive structural data is still emerging, preliminary analyses suggest similarities to regulatory proteins involved in transcriptional control mechanisms. The protein likely shares functional domains with other regulatory proteins in B. subtilis, such as Rok (YkuW), which is known to act as a negative regulator of gene expression .

Like many proteins in the Bacillus genus, yrkK may contain DNA-binding motifs that facilitate its interaction with specific genomic regions. Current structural predictions suggest the presence of helix-turn-helix domains characteristic of transcriptional regulators, though crystallographic confirmation remains pending.

How does the yrkK gene fit within the genomic context of Bacillus subtilis?

The yrkK gene exists within the complex and highly adaptive genome of Bacillus subtilis. B. subtilis exhibits considerable genome diversity across different strains, with strain-specific genes contributing to their adaptation to diverse environments . The gene is likely part of the accessory genome rather than the core genome, as comparative genomic analyses have revealed substantial variability in nearly all functional categories of genes across B. subtilis strains .

The yrkK gene may be part of the variable genetic elements that contribute to the remarkable adaptability of B. subtilis to different ecological niches. This variability has been observed in genes encoding for carbohydrate metabolism, amino acid uptake, and cell surface-associated proteins involved in environmental sensing .

What expression patterns does yrkK demonstrate under standard laboratory conditions?

Under standard laboratory conditions, yrkK typically demonstrates low expression levels, consistent with many uncharacterized regulatory proteins in B. subtilis. Expression patterns may vary depending on growth phase, with potential upregulation during transitions between exponential and stationary phases.

The regulation of yrkK may follow patterns similar to other regulatory genes in B. subtilis, potentially being influenced by global regulators like SinR and AbrB, which are known to control the expression of numerous genes, including those encoding regulatory proteins like Rok . Based on studies of similar regulatory systems, yrkK expression may be subject to autoregulation or feedback inhibition mechanisms.

What are the current hypotheses regarding the functional role of yrkK in Bacillus subtilis?

Current research hypotheses regarding yrkK function center around several possibilities based on sequence homology and genomic context:

  • Transcriptional regulation: The protein may function similarly to Rok (YkuW) as a transcriptional regulator, potentially binding to specific DNA sequences to control gene expression .

  • Involvement in competence development: Given the significance of regulatory networks in B. subtilis competence, yrkK might participate in the complex regulatory cascade that controls genetic competence, possibly interacting with established regulators like ComK .

  • Role in biofilm formation: The protein could potentially contribute to regulatory networks governing biofilm development, which is a well-studied adaptation in B. subtilis strains like NCIB3610 .

  • Environmental adaptation function: The protein may contribute to the adaptability of B. subtilis to specific environmental conditions, as suggested by the variability of regulatory genes across different strains .

Testing these hypotheses requires multiple experimental approaches, including gene knockout studies, chromatin immunoprecipitation experiments to identify DNA binding sites, and transcriptome analysis under various environmental conditions.

What experimental challenges are commonly encountered when expressing and purifying recombinant yrkK?

Researchers frequently encounter several challenges when working with recombinant yrkK:

  • Solubility issues: The protein may form inclusion bodies when overexpressed in E. coli or other heterologous systems, necessitating optimization of expression conditions (temperature, inducer concentration) or the use of solubility tags.

  • Stability concerns: Purified yrkK may exhibit limited stability in solution, requiring careful buffer optimization to maintain native conformation during purification and subsequent experiments.

  • Expression level variability: Expression yields may vary significantly between different expression systems and growth conditions, requiring systematic optimization.

  • Functional activity maintenance: Preserving the functional activity of yrkK during purification presents challenges, particularly if the protein requires specific cofactors or interacting partners for stability.

  • Post-translational modifications: If native yrkK undergoes post-translational modifications in B. subtilis, these may be absent in heterologous expression systems, potentially affecting protein function and structure.

To address these challenges, researchers typically employ a multi-faceted approach, testing various expression systems (E. coli BL21(DE3), Arctic Express, B. subtilis expression systems), different fusion tags (His, GST, MBP), and a range of buffer conditions during purification.

How does yrkK potentially interact with other regulatory networks in Bacillus subtilis?

Based on studies of similar regulatory proteins in B. subtilis, yrkK likely participates in complex regulatory networks through several potential mechanisms:

  • Direct protein-protein interactions with other regulators, forming regulatory complexes that cooperatively control gene expression.

  • Competitive binding to shared DNA targets, potentially opposing or reinforcing the activity of other regulators like Rok or ComK .

  • Hierarchical regulation cascades, where yrkK may be positioned within regulatory pathways controlled by global regulators such as SinR and AbrB, which are known to influence the expression of many genes in B. subtilis .

  • Integration with environmental sensing pathways, potentially responding to specific environmental cues and subsequently affecting downstream regulatory targets.

The elucidation of these potential interactions requires comprehensive interaction studies, including bacterial two-hybrid screens, co-immunoprecipitation experiments, and ChIP-seq analysis to identify shared or competitive binding sites with other regulators.

What are the most effective expression systems for producing recombinant yrkK protein?

The most effective expression systems for recombinant yrkK production include:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, ease of use, rapid growthPotential inclusion body formation, lack of B. subtilis-specific post-translational modificationsLower induction temperature (16-18°C), reduced IPTG concentration (0.1-0.3 mM), co-expression with chaperones
B. subtilis WB800Native expression environment, appropriate post-translational modificationsLower yields compared to E. coli, more complex genetic manipulationOptimization of promoter strength, signal peptide selection, protease-deficient strains
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, limited scaleSupplementation with chaperones, optimization of redox conditions
Insect cell systemsEnhanced folding for complex proteinsTime-consuming, expensiveOptimized signal peptides, co-expression with folding factors

When expressing yrkK in E. coli systems, fusion partners such as MBP (maltose-binding protein) often improve solubility while maintaining activity. Expression in the native B. subtilis host under controlled conditions offers the advantage of proper folding in the native cellular environment but typically yields lower protein amounts.

Regardless of the expression system chosen, purification commonly employs affinity chromatography (typically His-tag or GST-tag) followed by size exclusion chromatography to achieve high purity suitable for functional and structural studies.

What bioinformatic approaches are most valuable for analyzing the potential function of yrkK?

Several bioinformatic approaches provide valuable insights into yrkK function:

  • Homology modeling and structural prediction: Tools like AlphaFold, I-TASSER, or SWISS-MODEL can predict the three-dimensional structure of yrkK based on homologous proteins with known structures, providing insights into potential functional domains.

  • Comparative genomic analysis: Examining the conservation and genetic context of yrkK across different B. subtilis strains can reveal patterns of co-evolution with functionally related genes .

  • Motif identification: Programs like MEME and FIMO can identify potential DNA-binding motifs in yrkK, suggesting possible regulatory targets.

  • Protein-protein interaction prediction: Tools such as STRING and PSICQUIC can predict potential interaction partners based on co-expression patterns, genomic proximity, and experimental data from related proteins.

  • Phylogenetic profiling: Analyzing the evolutionary history of yrkK across Bacillus species and related genera can provide context about its conservation and potential functional importance.

These computational approaches should be used as hypothesis-generating tools to guide subsequent experimental validation, rather than as definitive evidence of function.

What are the most informative knockout and complementation strategies for studying yrkK function?

Effective knockout and complementation strategies for studying yrkK function include:

  • Clean deletion methodology: The most informative approach involves creating a marker-free deletion of yrkK using techniques like Cre-lox recombination or CRISPR-Cas9 editing, minimizing polar effects on neighboring genes.

  • Conditional knockout systems: For essential genes or those with growth stage-specific functions, conditional systems like xylose-inducible or IPTG-controlled expression provide temporal control over gene expression.

  • Complementation approaches:

    • Single-copy chromosomal integration at neutral sites (amyE, thrC) for physiological expression levels

    • Plasmid-based complementation with tunable promoters to evaluate dosage effects

    • Expression of yrkK variants with specific domain mutations to identify critical functional regions

  • Cross-species complementation: Testing whether yrkK orthologs from other Bacillus species can complement a B. subtilis yrkK deletion provides insights into functional conservation.

When designing knockout experiments, researchers should consider potential regulatory roles of yrkK by evaluating phenotypes under various growth conditions, particularly those that might trigger stress responses or developmental transitions similar to competence development or biofilm formation, which are known to involve complex regulatory networks in B. subtilis .

How should researchers interpret transcriptomic data following yrkK deletion or overexpression?

Interpreting transcriptomic data following yrkK manipulation requires a systematic analytical approach:

  • Primary analysis considerations:

    • Differentiate between direct and indirect regulatory effects using temporal expression profiling

    • Compare expression changes with known regulons of established B. subtilis regulators like Rok, ComK, SinR, and AbrB

    • Analyze expression changes in different growth phases to identify stage-specific regulatory roles

  • Data validation approaches:

    • Confirm key expression changes using RT-qPCR for selected target genes

    • Correlate transcriptomic changes with phenotypic observations

    • Validate direct binding to promoter regions of affected genes using ChIP-seq or EMSA assays

  • Network analysis:

    • Employ Gene Ontology enrichment analysis to identify functional categories of affected genes

    • Use clustering approaches to identify co-regulated gene sets

    • Integrate findings with existing B. subtilis regulatory network models

When interpreting transcriptomic data, researchers should be cautious about attribution of direct regulatory relationships without supporting binding data, as transcriptional changes may result from complex regulatory cascades rather than direct yrkK-mediated regulation.

What control experiments are essential when characterizing DNA-binding properties of yrkK?

Essential control experiments for characterizing yrkK DNA-binding properties include:

  • Specificity controls:

    • Competition experiments with specific and non-specific DNA sequences

    • Mutation analysis of predicted binding sites to identify critical nucleotides

    • Comparison of binding affinities across various target sequences

  • Technical controls:

    • Inclusion of known DNA-binding proteins (positive control) and non-DNA-binding proteins (negative control)

    • Assessment of tag influence on binding by comparing tagged and untagged protein versions

    • Buffer optimization to ensure physiologically relevant binding conditions

  • Validation experiments:

    • Correlation of in vitro binding results with in vivo occupancy (ChIP-seq)

    • Functional confirmation through reporter gene assays

    • Comparative binding analysis with related regulatory proteins like Rok

  • Physical parameter assessment:

    • Evaluation of binding under varying conditions (pH, salt concentration, temperature)

    • Analysis of binding cooperativity and multimerization effects

    • Assessment of potential cofactor requirements for DNA binding

These control experiments collectively ensure that observed DNA-binding properties reflect genuine biological activities rather than experimental artifacts or non-specific interactions.

How might understanding yrkK function contribute to our knowledge of bacterial adaptive responses?

Understanding yrkK function could significantly enhance our knowledge of bacterial adaptation through several avenues:

  • Regulatory network architecture: Characterizing yrkK's role would provide insights into how B. subtilis integrates multiple regulatory inputs to coordinate adaptive responses, potentially revealing new principles of bacterial gene regulation .

  • Strain-specific adaptation: Given the genomic diversity observed across B. subtilis strains, understanding yrkK function may illuminate how strain-specific regulators contribute to adaptation to particular ecological niches .

  • Evolutionary insights: Comparing yrkK function across different Bacillus species could reveal evolutionary trajectories of regulatory networks and how they diversify to enable adaptation to different environments.

  • Stress response mechanisms: If yrkK participates in stress responses, its characterization would expand our understanding of how bacteria sense and respond to environmental challenges through coordinated gene expression changes.

  • Development of synthetic biology tools: Understanding yrkK's regulatory mechanisms could provide new components for synthetic gene circuits in B. subtilis, enhancing our ability to engineer this organism for biotechnological applications.

The study of uncharacterized regulators like yrkK is essential for completing our picture of bacterial regulatory networks, which often involve complex hierarchies and feedback mechanisms that remain incompletely understood even in model organisms like B. subtilis .

What emerging technologies could accelerate the functional characterization of yrkK?

Several emerging technologies hold promise for accelerating yrkK characterization:

  • CRISPR interference (CRISPRi) for targeted gene repression: This allows temporal and graduated control of yrkK expression without complete deletion, enabling dosage-dependent phenotypic analyses.

  • Single-cell transcriptomics: This approach can reveal cell-to-cell variability in responses to yrkK manipulation, potentially identifying subpopulations with distinct regulatory states.

  • Proximity labeling techniques (BioID, APEX): These methods can identify proteins physically interacting with yrkK in vivo, providing insights into its participation in protein complexes.

  • Cryo-electron microscopy: Advancing structural biology techniques enable determination of protein structures at near-atomic resolution, potentially revealing molecular mechanisms of yrkK function.

  • High-throughput automated phenotyping: These platforms enable comprehensive phenotypic characterization of yrkK mutants under hundreds of different growth conditions simultaneously.

  • DNA-protein interaction mapping technologies: HT-SELEX and DAP-seq provide comprehensive identification of DNA-binding motifs and genomic binding sites with higher throughput than traditional approaches.

Integration of these technologies with established biochemical and genetic approaches will likely accelerate the functional characterization of yrkK and similar uncharacterized regulatory proteins in B. subtilis.

What are the key outstanding questions regarding yrkK that merit further investigation?

Several critical questions about yrkK remain unresolved and warrant dedicated research efforts:

  • Definitive functional role: What is the primary physiological function of yrkK in B. subtilis, and under what conditions is this function most relevant?

  • Regulatory targets: What specific genes or operons are directly regulated by yrkK, and what is the consensus binding motif for this protein?

  • Regulatory control: How is yrkK expression itself regulated, and does it participate in feedback loops similar to those observed for Rok and ComK ?

  • Structural determinants of function: What structural features enable yrkK to recognize its targets, and how does structure relate to function?

  • Strain-specific differences: How does yrkK function vary across different B. subtilis strains, and does this contribute to strain-specific adaptations ?

  • Integration with global regulatory networks: How does yrkK interact with established regulatory proteins like SinR, AbrB, and ComK in B. subtilis ?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.