Recombinant Bacillus subtilis Uncharacterized protein yrvD (yrvD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant yrvD is produced via:

  1. Cloning: Insertion of the yrvD gene into expression vectors.

  2. Expression: Induced in E. coli or yeast systems.

  3. Purification: Affinity chromatography using the His-tag.

Key challenges include maintaining protein stability during repeated freeze-thaw cycles and optimizing folding in non-native hosts. Protease-free strains like B. subtilis WB800 derivatives are often used in related recombinant protein production to reduce degradation , though yrvD is expressed in E. coli.

Research Applications and Context

While yrvD remains functionally uncharacterized, its study aligns with broader efforts to:

ApplicationRationaleRelevance
Structural AnalysisElucidate transmembrane topology and potential functional domains.
Functional AssaysScreen for enzymatic activity or ligand binding.
Comparative GenomicsIdentify homologs in other Bacillus species or Gram-positive bacteria.

Bacillus subtilis is a preferred host for recombinant protein production due to its:

  • Efficient secretion systems (Sec and Tat pathways) .

  • Non-pathogenic status (GRAS certification) .

  • High-yield fermentation capabilities .

Though yrvD is expressed in E. coli, its origin in B. subtilis underscores the bacterium’s role in producing industrially relevant proteins, including enzymes, vaccines, and therapeutic agents .

Challenges and Future Directions

  1. Functional Elucidation: Studies to determine yrvD’s role in B. subtilis physiology (e.g., stress response, membrane transport).

  2. Stability Optimization: Engineering mutations to enhance solubility or thermal stability.

  3. High-Throughput Screening: Leveraging yrvD as a model for testing novel expression systems or secretion pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yrvD; BSU27630; Uncharacterized protein YrvD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yrvD
Target Protein Sequence
MNKQWTIIFALIFTLIVAIFAVINVRSVEVDYLFGRSEWPLILVILGSVLMGALIVFSVG IFQVMKLKREIKTLRKENRTAIHKQEDTHLADQTDTQDASAMIEKKD
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it significant for recombinant protein research?

Bacillus subtilis is a rod-shaped, Gram-positive bacterium primarily found in soil, air, and decomposing plant matter. Initially named Vibrio subtilis in 1835, it was reclassified by Ferdinand Julius Cohn in 1872 . This organism has become increasingly important in recombinant protein research due to several advantageous characteristics. B. subtilis features outstanding capabilities for protein secretion, which greatly facilitates downstream processing of expressed proteins . Unlike many other expression systems, B. subtilis is non-pathogenic, has GRAS (Generally Recognized As Safe) status, and does not produce endotoxins that could contaminate the final product.

The bacterium's ability to form endospores enables it to survive extreme environmental conditions, making it a robust organism for various laboratory applications . In industry, B. subtilis produces important enzymes such as amylase and subtilisin, utilized in textile, paper, and detergent manufacturing . Its well-characterized genetics and natural competence for DNA transformation make it an excellent candidate for genetic engineering and heterologous protein expression.

What are uncharacterized proteins in B. subtilis and why are they worth studying?

Uncharacterized proteins (often annotated as y-proteins in B. subtilis) are gene products whose functions remain unknown or incompletely understood. Approximately 20-25% of bacterial genes remain uncharacterized, representing a significant knowledge gap in bacterial genomics . These proteins are worth studying for several compelling reasons:

  • Potential novel functions: Many uncharacterized proteins may have unique or unexpected biological roles that could advance our understanding of bacterial physiology.

  • Evolutionary insights: Analysis of these proteins can reveal evolutionary relationships and adaptation mechanisms, as evidenced by genomic phylostratigraphy approaches .

  • Biotechnological applications: Discovering the functions of these proteins may lead to new biotechnological tools and applications.

  • Understanding bacterial survival: Many uncharacterized proteins contribute to essential processes like sporulation. For instance, research has shown that 43% of tested uncharacterized genes affected sporulation when inactivated .

What experimental approaches are most effective for initial characterization of yrvD?

Initial characterization of yrvD should follow a multi-faceted approach combining both in silico and laboratory methods:

In silico analysis:

  • Sequence homology analysis against characterized proteins

  • Structural prediction using tools like AlphaFold

  • Genomic context analysis to identify potential functional partners

  • Evolutionary analysis through genomic phylostratigraphy

Laboratory approaches:

  • Gene knockout/inactivation studies to observe phenotypic changes

  • Heterologous expression and purification for biochemical characterization

  • Localization studies using fluorescent protein tags

  • Gene expression analysis under various conditions

A systematic phenotypic screening approach similar to that used for other uncharacterized proteins in B. subtilis has proven effective, with sporulation assays being particularly informative as they revealed functional roles for 16 out of 37 previously uncharacterized genes .

What are the optimal conditions for expressing recombinant yrvD protein in B. subtilis?

Optimal expression of recombinant yrvD protein in B. subtilis would likely benefit from the following conditions based on studies of similar proteins:

Expression strain selection:

  • Use genome-minimized strains that lack extracellular proteases, prophages, and genes for spore development, as these features have been shown to enhance recombinant protein production

  • Consider strains optimized for protein secretion if extracellular production is desired

Expression parameters to optimize:

  • Induction timing and duration (4-6 hours has been shown optimal for some B. subtilis recombinant proteins)

  • Temperature (typically 30-37°C)

  • Media composition

  • Inducer concentration

Media composition considerations:
The following table outlines key parameters that should be tested in a factorial design:

ParameterRange to testNotes
Carbon source0.5-2%Glucose, glycerol, etc.
Nitrogen source0.5-2%Yeast extract, tryptone
Induction OD0.6-2.0Mid to late log phase
Temperature25-37°CLower may improve solubility
Inducer concentration0.1-1.0 mMDependent on promoter

Multivariate analysis should be employed to determine optimal conditions, as this approach is more thorough than the traditional univariant method and enables characterization of experimental error .

How can statistical experimental design improve yrvD expression yields?

Statistical experimental design can significantly improve yrvD expression by systematically identifying optimal conditions while minimizing the number of experiments. This approach offers several advantages over traditional one-factor-at-a-time methods:

A recommended approach would be a fractional factorial screening design (such as a 2^8-4 design) with two levels for each variable and central point replicates. This has proven effective for other recombinant proteins, increasing yields by orders of magnitude .

Key variables to include in the experimental design:

  • Media composition (carbon source, nitrogen source, salt concentration)

  • Growth conditions (temperature, pH, aeration)

  • Induction parameters (inducer concentration, induction timing, harvest time)

  • Strain-specific factors (promoter strength, signal peptide selection)

What purification strategies work best for recombinant B. subtilis proteins like yrvD?

Purification of recombinant B. subtilis proteins can be approached through several strategies, with the optimal method depending on protein characteristics and expression approach:

For intracellular expression:

  • Cell lysis optimization (sonication, high-pressure homogenization, or enzymatic lysis)

  • Initial clarification through centrifugation and/or filtration

  • Chromatographic separation sequence:

    • Capture step: Affinity chromatography (if using tags like His6 or GST)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

For secreted proteins:

  • Separate cells from culture supernatant

  • Concentrate protein using ultrafiltration/tangential flow filtration

  • Apply similar chromatographic sequence as above

Considerations for yrvD purification:

  • If protein stability is an issue, consider adding protease inhibitors

  • Optimize buffer conditions (pH, salt concentration, reducing agents) at each step

  • Consider native purification versus denaturing/refolding approaches if inclusion bodies form

For proteins with disulfide bonds, B. subtilis offers advantages through its protein secretion pathway, as demonstrated in recent studies where genome-minimized strains achieved significantly improved secretion of active proteins with multiple disulfide bonds .

What techniques can reveal potential roles of yrvD in B. subtilis sporulation?

Investigating yrvD's potential role in sporulation should employ a systematic approach:

Genetic approaches:

  • Gene knockout/deletion studies with quantitative sporulation efficiency measurements

  • Complementation analysis to confirm phenotypes

  • Expression profiling during sporulation using qRT-PCR or RNA-seq

  • Sporulation-specific promoter analysis

Microscopy techniques:

  • Phase contrast microscopy to observe spore morphology changes (as shown with other B. subtilis strains)

  • Fluorescence microscopy with yrvD-GFP fusions to track localization during sporulation

  • Electron microscopy to examine ultrastructural changes in spores (similar to approaches in search result )

Biochemical methods:

  • Pull-down assays to identify protein interaction partners

  • Resistance properties assessment using standardized tests for heat, radiation, and chemical challenges

Given that 43% of tested uncharacterized genes affected sporulation in previous studies , there is a reasonable probability that yrvD may also influence this process. The analysis should include quantitative measures of sporulation efficiency and careful morphological characterization of any aberrant phenotypes.

How can evolutionary analysis help predict the function of yrvD?

Evolutionary analysis offers powerful insights into potential protein functions through several approaches:

Genomic phylostratigraphy:
This approach, successfully applied to B. subtilis sporulation genes , examines when genes emerged during evolutionary history. By determining the evolutionary age of yrvD and comparing it to genes with known functions that emerged in the same evolutionary period, researchers can make informed predictions about its potential role.

Comparative genomics:

  • Analyze the presence/absence of yrvD across bacterial species

  • Examine gene neighborhood conservation (synteny analysis)

  • Identify co-evolution patterns with genes of known function

Sequence-based analysis:

  • Identify conserved domains and motifs

  • Compare evolutionary rates across different regions of the protein

  • Detect signatures of selection pressure

A table showing phylostratigraphic mapping could provide valuable context:

PhylostratumEvolutionary emergenceKnown B. subtilis proteinsPotential yrvD connection
1UniversalCore metabolic proteinsFundamental cellular process
2BacteriaCell wall biosynthesisBasic bacterial functions
3FirmicutesSporulation initiationPossible sporulation role
............

What proteomic approaches are most effective for studying yrvD interactions?

Proteomic approaches offer powerful tools for elucidating yrvD interactions and potential functions:

Affinity-based methods:

  • Tandem affinity purification (TAP) tagging of yrvD

  • Co-immunoprecipitation with antibodies against yrvD

  • Pull-down assays using recombinant yrvD as bait

Mass spectrometry-based approaches:

  • Proximity-dependent biotin identification (BioID)

  • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Quantitative interaction proteomics comparing wild-type and yrvD mutant strains

Structural proteomics:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces

  • Thermal proteome profiling to identify proteins stabilized by yrvD interaction

Visualization techniques:

  • Förster resonance energy transfer (FRET) for in vivo interaction detection

  • Split-protein complementation assays (e.g., BIFC)

  • Fluorescence correlation spectroscopy for dynamic interactions

Integration of these approaches with bioinformatic predictions would provide a comprehensive interaction network for yrvD. For example, if genomic context analysis suggests yrvD may function in a particular pathway, targeted protein-protein interaction studies focusing on known components of that pathway would be appropriate.

How do post-translational modifications affect yrvD function and stability?

Post-translational modifications (PTMs) can significantly impact protein function and stability. For yrvD research, consider the following approaches:

Identification of PTMs:

  • Mass spectrometry-based proteomics to identify modifications

  • Site-directed mutagenesis of potential modification sites

  • Western blotting with PTM-specific antibodies

Functional impact analysis:

  • Compare activity/stability of modified versus unmodified protein

  • Create point mutations at modification sites and assess phenotypic changes

  • Express yrvD in systems with different PTM capabilities

Stability considerations:

  • Thermal shift assays to assess protein stability with/without modifications

  • Limited proteolysis to identify structural changes due to PTMs

  • Long-term storage tests under various conditions

B. subtilis is known to perform various PTMs including phosphorylation, glycosylation, and disulfide bond formation . If yrvD contains disulfide bonds, the recent advances in expressing disulfide-bonded proteins in genome-minimized B. subtilis strains would be particularly relevant .

How should contradictory results in yrvD functional studies be interpreted?

Contradictory results in functional studies of uncharacterized proteins like yrvD are common and require systematic investigation:

Sources of contradictions:

  • Strain-specific effects: Different laboratory strains may have subtle genetic differences

  • Experimental conditions: Temperature, media composition, growth phase

  • Genetic redundancy: Other proteins may compensate for yrvD in certain contexts

  • Pleiotropic effects: yrvD may have multiple functions depending on conditions

  • Technical variations: Different assay sensitivities or methodologies

Resolution strategies:

  • Standardize experimental conditions across laboratories

  • Use multiple complementary approaches to test each hypothesis

  • Create double/triple mutants to address redundancy

  • Employ quantitative rather than qualitative measures

  • Consider condition-dependent functions

Documentation framework:

  • Create a comprehensive table documenting all experimental conditions

  • Systematically test variables that differ between contradictory studies

  • Utilize statistical methods to determine significant factors

In studies of B. subtilis spores, researchers have observed different morphologies and germination capabilities even within the same sample , highlighting the importance of quantitative approaches and large sample sizes when characterizing phenotypes.

What are the challenges in scaling up yrvD production for structural studies?

Scaling up yrvD production for structural studies presents several challenges that require systematic approaches:

Expression system optimization:

  • Selection between intracellular expression versus secretion

  • Evaluation of genome-minimized B. subtilis strains that have shown 3000-fold increased secretion of other proteins

  • Codon optimization for B. subtilis expression

Bioreactor considerations:

  • Oxygen transfer rate optimization

  • pH control strategy

  • Feeding strategy for high-cell-density cultivation

Protein quality challenges:

  • Maintaining proper folding at high expression levels

  • Preventing aggregation during concentration steps

  • Ensuring homogeneity of post-translational modifications

Purification scale-up issues:

  • Column loading capacity limitations

  • Buffer consumption and waste management

  • Maintaining protein stability during extended purification

For structural studies requiring isotopic labeling (NMR) or selenomethionine incorporation (X-ray crystallography), specialized media formulations and expression protocols will be needed. The experimental design methodology described in result would be particularly valuable for optimizing these complex processes.

What bioinformatic approaches best predict yrvD function?

Predicting the function of uncharacterized proteins like yrvD requires integrating multiple bioinformatic approaches:

Sequence-based methods:

  • Profile Hidden Markov Models for remote homology detection

  • Position-Specific Scoring Matrices to identify conserved functional motifs

  • Analysis of intrinsically disordered regions and their potential binding sites

Structure-based predictions:

  • AlphaFold2 or RoseTTAFold for accurate structure prediction

  • Structural comparison against databases of known protein structures

  • Active site prediction through structural analysis

Genomic context methods:

  • Gene neighborhood analysis across multiple genomes

  • Phylogenetic profiling to identify co-occurring genes

  • Gene fusion detection for functional associations

Expression data integration:

  • Co-expression network analysis

  • Condition-specific expression patterns

  • Regulatory network positioning

A powerful approach would be to integrate these predictions into a consensus functional hypothesis, weighted by confidence scores from each method. For example, if yrvD shows structural similarity to sporulation proteins and is co-expressed with known sporulation genes, further experimental investigation of its role in sporulation would be warranted, similar to the approach used for other uncharacterized B. subtilis genes .

How can systems biology approaches advance understanding of yrvD function?

Systems biology offers comprehensive frameworks for understanding yrvD within the broader context of B. subtilis biology:

Network-based approaches:

  • Integration of yrvD into protein-protein interaction networks

  • Metabolic modeling to predict effects of yrvD perturbation

  • Regulatory network analysis to identify controlling factors

Multi-omics integration:

  • Correlate transcriptomic, proteomic, and metabolomic data

  • Identify condition-specific activation patterns

  • Map yrvD to specific cellular processes through perturbation studies

Computational modeling:

  • Kinetic modeling of pathways potentially involving yrvD

  • Agent-based simulations of cellular processes

  • Machine learning approaches to predict functional interactions

Evolutionary systems biology:

  • Mapping yrvD to evolutionary age groups (phylostrata)

  • Analysis of selection pressure across different bacterial lineages

  • Co-evolution networks with functionally related proteins

This integrative approach has proven valuable for understanding other uncharacterized bacterial proteins. For example, evolutionary analysis of B. subtilis sporulation genes revealed distinct evolutionary origins for different components of the sporulation process , providing insights that could similarly illuminate yrvD's role.

What emerging technologies will improve characterization of proteins like yrvD?

Several emerging technologies show promise for advancing research on uncharacterized proteins like yrvD:

CRISPR-based technologies:

  • CRISPRi for precise transcriptional control to study dosage effects

  • CRISPR-Cas9 for rapid generation of multiple mutants

  • CRISPR screening for high-throughput functional analysis

Single-cell approaches:

  • Single-cell proteomics to detect cell-to-cell variation

  • Time-lapse microscopy with fluorescent reporters

  • Microfluidic devices for controlled environmental perturbations

Structural biology advances:

  • Cryo-electron microscopy for structure determination without crystallization

  • Integrative structural biology combining multiple data types

  • AlphaFold2 and related AI methods for structure prediction

Synthetic biology tools:

  • Minimal genome approaches to simplify the cellular context

  • Biosensors for real-time monitoring of protein activity

  • Cell-free expression systems for rapid protein characterization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.