Recombinant Bacillus subtilis Uncharacterized protein ytvB (ytvB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YtvB Production

Recombinant YtvB is produced using B. subtilis or Escherichia coli expression systems, with variations in sequence length, purification tags, and secretion strategies. Key features include:

ParameterDetails
Source OrganismBacillus subtilis (strain 168)
Expression HostE. coli (common) or B. subtilis
Protein LengthPartial (1-111 aa) or full-length (1-236 aa) variants
TagHis-tagged (N-terminal)
Purity>85% (SDS-PAGE) ; >90% for full-length variants
StorageTris/PBS-based buffer with glycerol; lyophilized or liquid at -20°C/-80°C

Expression Systems and Optimization

Recombinant YtvB production leverages B. subtilis’s secretion machinery and genetic tools:

Secretion Pathways in B. subtilis

PathwayMechanismRelevance to YtvB
Sec PathwayExports unfolded proteins via ATP hydrolysis .Likely route for extracellular secretion.
Tat PathwayTransports folded proteins using proton gradients .Potential for stabilized YtvB variants.
ABC TransportersATP-driven export for small proteins .Unlikely due to YtvB’s size (>10 kDa).

Promoters and Induction

  • Inducible Systems: IPTG-induced promoters (e.g., P<sub>grac212</sub>) enhance cytoplasmic yields .

  • Self-Induction: Glucose-repressed systems reduce costs (e.g., P<sub>srfA</sub> promoters) .

Research Findings

  • Yield Optimization: Full-length YtvB expressed in E. coli achieves >90% purity via His-tag affinity chromatography .

  • Protease Resistance: Secretion via Tat pathway reduces intracellular proteolysis .

  • Applications:

    • Biotechnological Tool: Used to study B. subtilis’s secretion mechanisms .

    • Antibody Production: Similar uncharacterized proteins have been tested for antibody fragment secretion .

Challenges and Future Directions

  • Proteolytic Degradation: Extracellular proteases in B. subtilis limit yields; knockout strains (e.g., WB800) are recommended .

  • Secretion Efficiency: Hybrid signal peptides (e.g., LipA) may improve translocation .

  • Functional Characterization: Further studies are needed to elucidate YtvB’s biological role.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing your specified tag.
Synonyms
ytvB; BSU30330; Uncharacterized protein YtvB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytvB
Target Protein Sequence
MKMLHQVLIACVIGGIMGILGHVKKRGRLEKPRMTKRFIYLGFLEDWFIGMTASILLVLS ADPDSGIQLVILSIISGYGGEAVLRSFDFVRELNSGGEPAESKRQTKTPPE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the amino acid sequence and domain organization of YtvB protein?

YtvB is characterized by a 111-amino acid sequence: MKmLHQVLIACVIGGIMGILGHVKKRGRLEKPRMTKRFIYLGFLEDWFIGMTASILLVLSADPDSGIQLVILSIISGYGGEAVLRSFDFVRELNSGGEPAESKRQTKTPPE . The protein features two primary domains:

  • N-terminal LOV (light-oxygen-voltage) domain: Similar to those found in plant phototropins, which function as blue-light sensing domains

  • C-terminal STAS (Sulfate Transporter and Anti-Sigma factor antagonist) domain: Involved in protein-protein interactions within the stress signaling pathway

Unlike other members of the RsbR family, YtvB lacks conserved threonine residues within its C-terminal STAS domain. Instead, it contains charged glutamate residues at these positions, which likely mimic the phosphorylated state of other family members . This structural distinction may explain its unique function as a positive regulator in the stress response pathway.

How does YtvB's structure differ from other paralogous proteins in Bacillus subtilis?

YtvB belongs to the RsbR family of proteins but exhibits several unique structural features that distinguish it from its five paralogous negative regulators:

  • Domain substitution: YtvB contains an N-terminal LOV domain instead of the globin-like domain found in other RsbR family members .

  • Lack of phosphorylation sites: The protein lacks the conserved threonine residues that are typically phosphorylated in the other family members, with glutamate residues at these positions instead .

  • Chromophore binding: YtvB uniquely binds an FMN chromophore that enables its photosensing capabilities .

These structural differences correlate with YtvB's distinct function as a positive regulator in the environmental signaling branch of the σB signal transduction network, contrasting with the negative regulatory roles of its paralogous proteins .

What evidence supports YtvB's role as a blue-light sensor in Bacillus subtilis?

Multiple lines of biochemical and genetic evidence establish YtvB's function as a blue-light sensor:

  • Photochemical properties: YtvB's LOV domain has photochemistry consistent with blue-light sensing, featuring a photocycle that closely resembles plant phototropin LOV domains .

  • Chromophore interaction: Upon blue-light illumination, the FMN chromophore forms a covalent linkage with cysteine 62 within the LOV domain, a critical part of the photocycle .

  • Conformational changes: Light-induced formation of the FMN-cysteine photoadduct alters the interaction between the LOV and STAS domains, likely transmitting the light signal to downstream components .

  • Structural similarity: The LOV domain of YtvB is similar to well-characterized blue-light sensors found in plant phototropins, which are established photoreceptors .

Losi and colleagues have demonstrated that purified YtvB binds an FMN chromophore that forms a photoadduct with a conserved cysteine upon blue-light illumination, confirming its light-sensing capabilities at the molecular level .

How does YtvB function within the environmental stress signaling pathway?

YtvB serves as a positive regulator in the environmental branch of the σB signal transduction network, which controls the general stress response in Bacillus subtilis:

  • Partner-switching mechanism: YtvB participates in a partner-switching mechanism where serine and threonine phosphorylation governs interactions among network components .

  • Signaling complex formation: Biochemical evidence shows that YtvB can be isolated from cell extracts as part of a large environmental signaling complex that includes at least three negative regulators .

  • Dual sensing capabilities: YtvB appears to provide B. subtilis with the ability to sense two discrete environmental parameters—one via control of ytvA expression and another via light-dependent control of YtvA domain interaction .

  • Stress response activation: When activated by diverse growth-limiting stresses, the σB regulon confers resistance against future, potentially lethal stresses, with YtvB playing a positive regulatory role in this activation process .

This integrated function allows Bacillus subtilis to incorporate light signals into its broader environmental stress response system.

What are the recommended protocols for recombinant expression and purification of YtvB?

Based on established research methodologies, the following protocol is recommended for recombinant expression and purification of YtvB:

Expression System:

  • Vector selection: Use pDG148 vector or equivalent, which places ytvA expression under the control of an IPTG-inducible Pspac promoter .

  • Host strain: Utilize E. coli expression systems optimized for recombinant protein production.

  • Induction conditions: Induce expression with IPTG at concentrations determined through optimization experiments.

Purification Strategy:

  • Buffer composition: Purify in Tris-based buffer optimized for protein stability .

  • Storage conditions: Store final protein in 50% glycerol at -20°C for regular use, or at -80°C for extended storage .

  • Handling precautions: Avoid repeated freezing and thawing; maintain working aliquots at 4°C for up to one week .

Quality Control:

  • Verify protein identity through mass spectrometry and/or western blotting.

  • Confirm structural integrity through circular dichroism spectroscopy.

  • Validate functional activity through chromophore binding and photocycle assessments.

This protocol ensures production of functional YtvB protein suitable for downstream biochemical and structural studies.

How can researchers design experiments to study YtvB's photochemical properties?

To systematically investigate YtvB's photochemical properties, researchers should implement the following experimental design approaches:

Spectroscopic Analysis:

  • Absorption spectroscopy: Monitor changes in absorption spectra before, during, and after blue light illumination to characterize the photocycle.

  • Fluorescence spectroscopy: Measure changes in FMN fluorescence to track conformational changes upon light activation.

  • Circular dichroism: Assess secondary structure changes associated with photoactivation.

Mutational Analysis:

  • Site-directed mutagenesis: Create point mutations such as C62A and C62S that alter the critical cysteine residue essential for photoadduct formation .

  • Domain deletion: Generate truncation mutants such as ytvAΔ1 (removing LOV domain residues 25-126) and ytvAΔ2 (removing LOV domain and downstream α-helix, residues 25-157) .

  • Reporter constructs: Develop transcriptional fusions between σB-dependent promoters and reporter genes (e.g., lacZ) to assess the functional impact of mutations .

Photophysical Characterization:

  • Light dose-response: Measure response parameters across different light intensities and wavelengths.

  • Kinetic analysis: Determine rates of photoadduct formation and decay using time-resolved spectroscopy.

  • Thermal recovery: Assess the temperature dependence of the dark recovery reaction.

Following established experimental design principles , these approaches should include appropriate controls, replication, and randomization to ensure statistical validity and reproducibility.

How can researchers investigate the interaction between YtvB and other components of the stress signaling pathway?

To elucidate the protein-protein interactions between YtvB and other stress signaling components, researchers should employ multiple complementary approaches:

Co-immunoprecipitation Studies:

  • Use antibodies against YtvB to isolate protein complexes from cell lysates.

  • Identify interaction partners through mass spectrometry-based proteomics.

  • Validate specific interactions through reciprocal co-immunoprecipitation experiments.

Yeast Two-Hybrid Analysis:

  • Screen for direct protein-protein interactions between YtvB and known components of the environmental signaling branch.

  • Map interaction domains through truncation and point mutation analysis.

  • Quantify interaction strengths under different conditions (light vs. dark).

In vitro Binding Assays:

  • Use purified recombinant proteins to assess direct physical interactions.

  • Employ surface plasmon resonance or isothermal titration calorimetry to determine binding affinities and kinetics.

  • Investigate how light activation affects binding properties.

Genetic Suppressor Screens:

  • Identify mutations in other pathway components that suppress or enhance ytvA mutation phenotypes.

  • Use these genetic interactions to build a functional map of the signaling pathway.

Researchers should consider how experimental design choices impact results , ensuring sufficient replication and appropriate statistical analysis of interaction data.

What methodological approaches can resolve the dual sensing capabilities of YtvB?

YtvB appears to sense both light and other environmental parameters, necessitating sophisticated experimental approaches to dissect these dual capabilities:

Response Surface Methodology:

  • Design factorial experiments varying multiple parameters simultaneously (light conditions, stress conditions, etc.).

  • Apply statistical modeling to identify interaction effects between different environmental variables.

  • Optimize experimental conditions for maximum response differentiation .

Gene Expression Analysis:

  • Use transcriptomics to identify genes differentially regulated by YtvB under various combinations of light and stress conditions.

  • Employ reporter constructs with ytvA promoter regions to identify regulatory elements responding to different environmental signals .

  • Analyze the kinetics of gene expression changes in response to individual and combined stimuli.

Domain Swap Experiments:

  • Create chimeric proteins exchanging domains between YtvB and other stress sensors.

  • Test the response of these chimeras to different environmental parameters.

  • Map specific sensing capabilities to distinct protein domains.

Time-Resolved Structural Studies:

  • Use techniques like hydrogen-deuterium exchange mass spectrometry to track conformational changes.

  • Apply time-resolved X-ray crystallography or cryo-EM to capture structural intermediates during activation.

  • Correlate structural changes with specific environmental inputs.

This methodological framework allows researchers to disentangle YtvB's responses to different environmental parameters and understand their integration at the molecular level.

What are the key unresolved questions in YtvB research?

Despite significant progress in understanding YtvB, several critical questions remain unanswered:

  • Signaling mechanism: How does light-induced structural change in the LOV domain propagate through the protein to affect its regulatory function in the stress signaling pathway?

  • Evolutionary significance: What selective advantage does blue-light sensing provide to a soil bacterium like Bacillus subtilis, and how is this function integrated with other stress responses?

  • Interaction specificity: How does YtvB specifically interact with different components of the stress signaling complex, and how do these interactions change upon light activation?

  • Regulatory network integration: How are signals from YtvB integrated with inputs from other environmental sensors to produce an appropriate stress response?

  • Temporal dynamics: What are the kinetics of YtvB activation and deactivation in vivo, and how do these kinetics influence stress response timing?

Addressing these questions will require integrative approaches combining structural biology, biochemistry, genetics, and systems biology methodologies .

How might advanced experimental design enhance research on YtvB function?

Advanced experimental design approaches can significantly enhance YtvB research by enabling more systematic and statistically robust investigations:

Mixture Designs:

  • Optimize buffer compositions for protein stability and activity assays.

  • Determine optimal combinations of environmental stress factors that activate YtvB-dependent pathways.

  • Identify synergistic or antagonistic effects between different experimental variables .

Fractional Factorial Designs:

  • Efficiently screen large numbers of potential factors affecting YtvB function.

  • Identify main effects and interactions with minimal experimental runs.

  • Guide subsequent focused experiments based on screening results .

Response Surface Methods:

  • Model the relationship between experimental factors (light intensity, wavelength, temperature) and YtvB activity.

  • Identify optimal conditions for specific YtvB functions.

  • Predict responses under untested conditions .

Robust Parameter Design:

  • Identify conditions under which YtvB function is most stable.

  • Minimize variability in experimental results.

  • Develop more reproducible assays for YtvB activity .

Implementation of these advanced design strategies will accelerate progress in understanding YtvB's complex functions by improving experimental efficiency and statistical power.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.