Recombinant Bacillus subtilis Uncharacterized protein yueC (yueC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
yueC; BSU31850; ESX secretion system protein YueC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yueC
Target Protein Sequence
MLSFSLFIPSAAAAQTEENTDVAPNQYEKKDIEIDTNYLHEDTYYEEKTELPEEQKDITF DKPKDKDAELIKDLFTSTNAEDSNTIAAQSKQLGITFAEKPMTKTSSTETEDEQETSSLL LPMIYVVLILLGIAGIVFLIPKVTAQENKKA
Uniprot No.

Target Background

Function
Required for YukE secretion. Likely a component or regulator of the ESX/ESAT-6-like secretion system (BsEss).
Database Links
Protein Families
EssA family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the YueC protein in Bacillus subtilis?

YueC is currently classified as a hypothetical protein in Bacillus subtilis with no fully characterized function . It is encoded within the yukEDCByueBC locus and appears to be a component of an Esat-6-like secretion system (Ess) . Based on protein interaction network analyses, YueC shows high confidence interactions with other proteins encoded in the same locus, particularly YueB (confidence score 0.938) . While initially designated with the prefix "y" indicating unknown function, progress in functional genomics continues to elucidate its role in bacterial physiology. As part of ongoing genome annotation refinements for B. subtilis, YueC remains one of the proteins awaiting complete functional characterization .

How is YueC evolutionarily conserved across bacterial species?

YueC appears to be part of a conserved secretion system that is widespread among bacteria of the phyla Actinobacteria and Firmicutes . The Type VII/Esat-6 secretion systems have been identified in multiple bacterial species, with variations in structure and function. In pathogenic bacteria like Staphylococcus aureus, homologous systems play important roles in host-pathogen interactions. YueC shares sequence or structural homology with known components of the S. aureus Ess, suggesting evolutionary conservation of this secretion pathway . Phylogenetic analysis would be necessary to fully map the evolutionary relationships of YueC across bacterial species, particularly focusing on the conservation patterns between pathogenic and non-pathogenic Firmicutes.

How does YueC contribute to the Esat-6-like secretion system function?

YueC appears to be an essential component of the functional Esat-6-like secretion system (Ess) in Bacillus subtilis. Evidence indicates that the secretion of YukE, a small protein from the WXG100 superfamily that serves as a secretion substrate, depends on intact yukDCByueBC genes, including yueC . When yueC is disrupted, the secretion pathway likely becomes non-functional, suggesting that YueC plays a critical structural or functional role in the assembly or operation of this secretion apparatus. The exact molecular mechanism by which YueC contributes to this system remains to be fully characterized, but its position in a conserved gene cluster with other Ess components strongly supports its involvement in protein secretion .

What regulatory factors control YueC expression and function?

The B. subtilis Ess, including the yueC component, primarily operates during late stationary growth phase . This temporal expression pattern is controlled by the DegS-DegU two-component system, specifically requiring phosphorylated DegU (DegU-P) . High levels of DegU-P activate this secretion system, suggesting that YueC expression is regulated as part of a coordinated stress response or adaptation to nutrient limitation. Researchers investigating YueC should consider growth phase-dependent expression patterns and design experiments accordingly, particularly focusing on late stationary phase cultures when studying the native expression and function of this protein .

How does YueC interact with other components of the yukEDCByueBC locus?

Protein interaction data from STRING database analysis reveals that YueC forms a functional network with several proteins encoded by the yukEDCByueBC locus . The interaction confidence scores provide insight into the strength of these associations:

Protein PartnerConfidence ScoreKnown/Predicted Function
YueB0.938Component of Ess
YukC0.983Conserved protein, Ess component
YukA0.979Conserved protein, Ess component
YukE0.959WXG100 family, secretion substrate
YukD0.800Ubiquitin-like protein, EsaB family

These high confidence scores indicate that YueC functions as part of a multiprotein complex involved in protein secretion . The interaction with YueB is particularly notable, suggesting these two proteins may work closely together within the secretion apparatus. Experimental approaches such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking studies would be valuable for confirming and further characterizing these protein-protein interactions.

What are the recommended methods for recombinant expression and purification of YueC?

For recombinant expression of YueC, researchers can adapt methods similar to those used for YukE purification . A recommended approach includes:

  • PCR amplification of the yueC coding sequence from B. subtilis genomic DNA

  • Cloning into an expression vector (e.g., pIVEX3.2d) that allows for C-terminal hexahistidine tagging

  • Expression in an E. coli strain optimized for protein production (e.g., BL21 derivatives)

  • Induction of protein expression through appropriate promoter activation

  • Cell lysis and purification using nickel affinity chromatography

  • Further purification steps such as ion exchange or size exclusion chromatography as needed

The purification buffer conditions should be optimized for YueC stability, potentially starting with conditions similar to those used for YukE: 50 mM HEPES pH 7.5, 200 mM NaCl, 10% glycerol . Since YueC may be a membrane-associated protein, the addition of mild detergents might be necessary for solubilization and purification. Protein purity should be assessed by SDS-PAGE and Western blotting using anti-His antibodies or custom-raised antibodies against YueC.

What genetic approaches are most effective for studying yueC function in B. subtilis?

Several genetic approaches can be employed to study yueC function:

  • Gene disruption using pMutin4-based integration, as described in the literature for creating yueC mutants . This approach allows for the assessment of the phenotypic consequences of yueC inactivation.

  • Complementation studies using expression constructs such as amyE::PxylA-yueC that allow for xylose-inducible expression of yueC . This approach can confirm whether observed phenotypes are specifically due to the absence of yueC.

  • Fluorescent protein tagging for localization studies to determine the subcellular distribution of YueC.

  • Construction of degU32(Hy) mutations to create strains with constitutively high levels of phosphorylated DegU, which activates the Ess . This can be useful for studying YueC in the context of an activated secretion system.

  • Creation of point mutations in conserved YueC domains to identify functionally critical residues.

For all genetic manipulations, researchers should confirm the genomic structure by PCR and sequencing to ensure the intended modifications have been correctly implemented .

How can researchers assess YueC's contribution to the Esat-6 secretion pathway?

To evaluate YueC's role in the Esat-6-like secretion pathway, researchers can:

  • Monitor the secretion of the known substrate YukE in wild-type vs. yueC mutant strains . This can be done by analyzing cell-free culture supernatants using:

    • Western blotting with anti-YukE antibodies

    • Mass spectrometry-based proteomics to identify secreted proteins

    • Activity assays if functional readouts for secreted substrates are available

  • Perform comparative transcriptomics or proteomics between wild-type and yueC mutant strains to identify genes and proteins whose expression or secretion depends on intact YueC.

  • Use bacterial two-hybrid or co-immunoprecipitation assays to map the protein-protein interaction network of YueC within the secretion apparatus.

  • Employ cross-linking experiments similar to those described for YukE to determine if YueC forms multimeric complexes .

  • Analyze the growth phase dependence of YueC expression and function, particularly focusing on late stationary phase when the Ess is most active .

These approaches should be performed under conditions known to activate the Ess, such as late stationary phase or in strains with high levels of phosphorylated DegU .

How might the function of YueC differ between laboratory and undomesticated B. subtilis strains?

Research indicates that the Esat-6-like secretion system functions in undomesticated B. subtilis strains but may have reduced activity in laboratory strains . This suggests potential differences in YueC function between these strain types. Undomesticated strains maintain natural traits that may have been lost during laboratory domestication, including robust biofilm formation, swarming motility, and certain secretion capabilities. When studying YueC, researchers should consider:

  • Comparing YueC expression and function between laboratory strain 168 and undomesticated strains

  • Assessing the impact of specific genetic differences between these strains on YueC activity

  • Evaluating whether domestication-related mutations affect the regulation or assembly of the Ess components including YueC

  • Determining if YueC's interaction partners differ between strain types

These comparative studies could reveal important insights into the natural function of YueC in B. subtilis ecology versus its role in laboratory-adapted settings .

What is the potential significance of YueC in bacterial cell-cell communication or virulence?

While B. subtilis is generally non-pathogenic, the homology between its Ess and similar systems in pathogenic bacteria suggests potential roles in intercellular communication or environmental interactions . In some pathogenic species, Type VII secretion systems contribute to virulence through the secretion of effector proteins that interact with host cells. For YueC research, important considerations include:

  • Investigating whether YueC-dependent secretion affects bacterial interactions with other microorganisms in mixed cultures

  • Examining the role of YueC in biofilm formation, which involves complex cell-cell communication

  • Determining if YueC-dependent secreted factors influence B. subtilis competition or cooperation with other soil microbes

  • Comparative analysis with homologous systems in pathogenic bacteria to identify conserved functional features

These investigations could reveal novel ecological functions for YueC beyond its structural role in the secretion apparatus and provide insights into the evolution of bacterial secretion systems across pathogenic and non-pathogenic species .

How does phosphorylated DegU regulate YueC and the associated secretion system at the molecular level?

The absolute dependence of the B. subtilis Ess on phosphorylated DegU presents an intriguing regulatory mechanism . Advanced research questions should address:

  • Whether DegU-P directly binds to the promoter regions of the yukEDCByueBC locus to activate transcription

  • If DegU-P regulates post-transcriptional or post-translational aspects of YueC function

  • How the DegU-P concentration influences the assembly or activity of the secretion apparatus

  • The kinetics of YueC expression and function in relation to DegU phosphorylation during growth phase transitions

Experimental approaches might include:

  • Chromatin immunoprecipitation to identify DegU-P binding sites

  • Reporter gene assays to quantify promoter activity under varying DegU-P levels

  • Pulse-chase experiments to determine protein stability and turnover

  • In vitro reconstitution of the regulatory system using purified components

Understanding this regulation could provide insights into how bacteria coordinate complex cellular processes in response to environmental conditions .

What are common challenges in detecting and analyzing YueC expression?

Researchers working with YueC may encounter several experimental challenges:

  • Low natural expression levels, particularly if not analyzing cells in late stationary phase when the Ess is most active

  • Difficulty in raising specific antibodies against YueC if it shares structural features with other proteins

  • Potential toxicity when overexpressing YueC in heterologous systems

  • Membrane association that may complicate extraction and purification procedures

To address these challenges, researchers can:

  • Use degU32(Hy) mutant strains to enhance expression of YueC and other Ess components

  • Employ epitope tagging approaches that don't interfere with protein function

  • Optimize induction conditions for recombinant expression to balance yield and toxicity

  • Develop specialized membrane protein extraction protocols using appropriate detergents

Additionally, researchers should carefully control for growth phase when analyzing YueC, as its expression appears to be highly growth phase-dependent .

How can researchers distinguish direct from indirect effects when studying YueC mutants?

When analyzing phenotypes of yueC mutants, distinguishing direct from indirect effects presents a significant challenge. Recommended approaches include:

  • Complementation studies: Reintroducing yueC expression in mutant strains should restore phenotypes directly related to YueC function. This can be achieved using constructs like amyE::PxylA-yueC for controlled expression .

  • Point mutations vs. complete disruption: Creating specific point mutations in functional domains rather than complete gene disruption can help identify direct functional relationships.

  • Conditional depletion: Using inducible systems to deplete YueC can help distinguish acute from adaptive effects of YueC absence.

  • Epistasis analysis: Examining double mutants with interacting components can reveal the position of YueC in functional pathways.

  • Time-course experiments: Monitoring changes immediately following YueC depletion versus long-term adaptations.

These approaches collectively provide stronger evidence for direct functional relationships between YueC and observed phenotypes compared to single gene knockout studies alone.

What are the best controls to include when studying YueC in the context of the Esat-6 secretion system?

Robust experimental design for YueC studies should include several key controls:

  • Strain controls:

    • Wild-type B. subtilis (positive control for intact secretion)

    • Mutants of other Ess components (yukE, yukD, yukC, yukB, yueB) for comparison

    • Complemented yueC mutant strains to confirm phenotype restoration

    • degU mutants to assess regulation

  • Growth phase controls:

    • Sampling at multiple time points, especially late stationary phase when the system is most active

    • Standardization of culture conditions to minimize variability

  • Secretion controls:

    • Analysis of non-secreted cytoplasmic proteins to confirm specificity

    • Monitoring of known secretion substrates like YukE

    • Analysis of secretion through alternative pathways to confirm specificity

  • Experimental validation controls:

    • Technical replicates to assess method reproducibility

    • Biological replicates using independently derived strains

    • Appropriate statistical analyses to determine significance

Inclusion of these controls ensures that observed effects can be confidently attributed to YueC function within the Esat-6-like secretion system.

What are the current gaps in YueC research and promising future directions?

Despite progress in understanding the yukEDCByueBC-encoded Esat-6-like secretion system, significant knowledge gaps remain regarding YueC:

  • The precise molecular function of YueC within the secretion apparatus remains undefined

  • The three-dimensional structure of YueC has not been determined

  • The complete set of proteins secreted through this pathway beyond YukE is unknown

  • The ecological significance of this secretion system in natural B. subtilis habitats is poorly understood

  • The evolutionary relationship between the B. subtilis Ess and similar systems in other bacteria requires further characterization

Promising research directions include:

  • Structural biology approaches to determine YueC's molecular architecture

  • Comprehensive secretome analysis to identify all substrates of this pathway

  • Ecological studies examining the role of this secretion system in microbial communities

  • Comparative genomics across bacterial species to track the evolution of this system

  • Investigation of potential biotechnological applications for controlled protein secretion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.