Recombinant Bacillus subtilis Uncharacterized protein yugM (yugM)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

YugM is typically expressed in Escherichia coli due to its scalability and cost efficiency. Key production parameters include:

Expression and Purification

  • Host System: E. coli BL21(DE3) or similar strains .

  • Vector: Plasmid-based systems with inducible promoters (e.g., T7/lac).

  • Purification: Immobilized metal affinity chromatography (IMAC) leveraging the His tag .

  • Yield: ~0.1–1.0 mg/mL after reconstitution, with >85% purity (SDS-PAGE verified) .

Research Applications

YugM is primarily used in:

  • Antigen Production: Generating antibodies for microbial proteomics studies .

  • Structural Biology: Preliminary crystallization trials due to its small size and solubility .

  • Functional Annotation: Comparative studies to elucidate roles in B. subtilis colony architecture or stress response .

Technological Advancements in B. subtilis Expression Systems

While YugM itself has not been studied extensively, recent advances in B. subtilis recombinant protein production inform its potential optimization:

Key Innovations

StrategyImpact on Protein Production
Secretion PathwaysSec/Tat systems enhance extracellular yield by directing proteins to culture medium .
Promoter EngineeringInducible (e.g., P<sub>grac212</sub>) or constitutive promoters improve expression control .
Protease Knockout StrainsMinimize degradation (e.g., WB800 strain) to stabilize recombinant proteins .

Challenges

  • Low Solubility: Membrane-associated proteins like YugM may require fusion tags or chaperones for proper folding .

  • Scalability: Batch-to-batch variability in E. coli systems affects industrial adoption .

Future Directions

  • Functional Studies: CRISPR-Cas9 editing of yugM in B. subtilis could clarify its role in bacterial physiology .

  • Biotechnological Optimization: Coupling YugM with self-inducing systems (e.g., quorum-sensing promoters) may enhance yield .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yugM; BSU31340; Uncharacterized protein YugM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yugM
Target Protein Sequence
MFMKQLVKHLIIAGFSAAILSFLISFDAVYTGFSSSFGGTLSHFFIHSFLLIGLPLALFT DAVHRILHLKRTHTLFTKLGLYATVVYVSWDSAVWLAAAMAVYFLIECAFFPVGRAKETT ISM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YugM protein in Bacillus subtilis?

YugM is classified as an uncharacterized hypothetical protein in Bacillus subtilis . As with many y-genes in B. subtilis, its precise function remains to be elucidated through targeted experimental approaches. The protein can be recombinantly expressed with affinity tags such as His-tag to facilitate purification and subsequent functional characterization studies . Standard expression systems for this protein include E. coli and yeast platforms, which allow for the production of sufficient quantities for biochemical and structural analyses .

How is recombinant YugM protein typically produced for research purposes?

Recombinant YugM protein production typically employs either E. coli or yeast expression systems . When expressed with a His-tag, the protein can be purified to >80% purity using standard affinity chromatography methods as verified by SDS-PAGE analysis . The resulting protein is typically provided in PBS buffer for short-term storage at 4°C, or at -20°C to -80°C for long-term storage . Researchers should note that recombinant preparations contain <1.0 EU per μg of endotoxin as determined by the LAL method, making them suitable for various experimental applications .

What is currently known about the genetic context of yugM in B. subtilis?

While specific information about yugM's genetic context is limited in the provided search results, research on similar uncharacterized genes (y-genes) in B. subtilis demonstrates they often participate in genetic interaction networks with characterized genes. For example, other uncharacterized genes like ypmB, yerH, and yabM have been shown to have positive genetic interactions with mbl, a paralog of the essential cell shape determinant mreB . This pattern suggests that uncharacterized genes like yugM may similarly have specific functional relationships with characterized genes that can be revealed through genetic interaction studies.

What are the recommended approaches for functional characterization of an uncharacterized protein like YugM?

A multifaceted approach is recommended for the functional characterization of YugM:

  • Genetic interaction studies: Implementing comprehensive double-mutant analysis, similar to methods used for other y-genes, to identify functional relationships. This involves creating gene knockouts or knockdowns using techniques like CRISPR-Cas9 with sgRNAs (fully complementary for full knockdown or mismatched for partial knockdown) .

  • Protein-protein interaction assays: Employing techniques such as co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling to identify interaction partners.

  • Structural analysis: Using X-ray crystallography, NMR spectroscopy, or cryo-EM to determine the three-dimensional structure, potentially revealing functional domains.

  • Expression profiling: Analyzing gene expression patterns under various conditions to identify regulatory patterns and potential functional contexts.

  • Comparative genomics: Examining conservation and evolutionary relationships to gain insights into potential functions.

How should researchers design genetic interaction experiments to investigate YugM function?

When designing genetic interaction (GI) experiments for YugM characterization, researchers should follow these methodological guidelines:

  • Systematic double-mutant creation: Generate combinations of yugM deletion/knockdown with other genes, prioritizing those in potentially related pathways.

  • Phenotypic analysis: Employ quantitative growth measurements to identify synthetic lethal, negative, or positive genetic interactions.

  • Control selection: Include appropriate controls such as known interacting gene pairs (e.g., bcrC and uppP which exhibit synthetic lethality ).

  • Knockdown calibration: Consider both full knockdowns using fully complementary sgRNAs and partial knockdowns using mismatched sgRNAs to capture a range of interaction strengths .

  • Environmental variation: Test interactions under multiple growth conditions to identify condition-specific functional relationships.

A scoring system should be implemented to quantify interaction strength, similar to approaches used in comprehensive B. subtilis genetic interaction studies .

What expression systems are most effective for studying the biochemical properties of YugM?

The selection of an expression system for YugM biochemical characterization should be guided by the specific experimental objectives:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, well-established protocolsPotential folding issues with B. subtilis proteins, lack of specific post-translational modificationsInitial biochemical characterization, structural studies requiring high protein quantities
YeastEukaryotic post-translational modifications, good for proteins toxic to bacteriaLower yield than E. coli, longer expression timeStudies requiring specific modifications or when bacterial expression is problematic
Native B. subtilisAuthentic processing and folding, natural post-translational modificationsLower yield, more complex purificationFunctional studies requiring native-like protein state

For most initial biochemical characterizations, E. coli expression with a His-tag appears to be the standard approach for YugM , providing sufficient purity (>80%) for preliminary studies.

How might researchers investigate potential genetic interactions between yugM and other uncharacterized genes in B. subtilis?

Investigating genetic interactions between yugM and other uncharacterized genes requires a systematic approach:

  • Targeted double-mutant library construction: Generate a matrix of double mutants combining yugM with other uncharacterized genes, particularly focusing on y-genes that have shown interaction patterns in previous studies.

  • High-throughput phenotyping: Implement automated growth curve analysis to quantify fitness effects across multiple conditions.

  • Interaction network mapping: Construct a network visualization of interactions to identify patterns and clusters of functionally related genes.

  • Transcriptomic profiling of double mutants: Analyze expression changes in double mutants compared to single mutants to identify compensatory mechanisms.

  • Clustering analysis: Group genes based on similarity of genetic interaction profiles to predict functional relationships.

This approach has been productive for other uncharacterized genes in B. subtilis, revealing functional connections. For example, similar studies have identified that certain uncharacterized genes (ypmB, yerH, and yabM) interact specifically with mbl but not with its paralog mreB, suggesting specialized functional roles .

What approaches can resolve contradictory data in YugM functional studies?

When facing contradictory data in YugM functional studies, researchers should implement the following resolution framework:

  • Experimental context analysis: Systematically examine differences in experimental conditions (media, growth phase, strain background) that might explain divergent results.

  • Technical validation: Use orthogonal techniques to verify key findings and eliminate method-specific artifacts.

  • Genetic background effects: Test for suppressor mutations or genetic modifiers by whole-genome sequencing of experimental strains.

  • Conditional functionality testing: Assess protein function across a range of environmental conditions, as some proteins display context-dependent functionality.

  • Concentration-dependent effects: Examine whether contradictory results might stem from different protein expression levels, potentially revealing concentration-dependent functionality.

  • Post-translational modification analysis: Investigate whether differences in post-translational modifications between expression systems explain functional discrepancies.

This systematic approach helps distinguish genuine biological complexity from experimental artifacts.

How can researchers distinguish between direct and indirect effects when studying YugM interactions with other cellular components?

Distinguishing direct from indirect interactions requires multiple complementary approaches:

The integration of these approaches provides strong evidence for distinguishing direct functional relationships from broader network effects.

What are the critical quality control parameters for recombinant YugM protein preparations?

Quality control for recombinant YugM preparations should include these critical parameters:

ParameterAcceptable RangeMethod of AssessmentImportance
Purity>80%SDS-PAGE Ensures experimental outcomes are attributable to YugM rather than contaminants
Endotoxin level<1.0 EU per μgLAL method Prevents endotoxin-mediated artifacts in biological assays
SolubilityNo visible precipitationVisual inspection and dynamic light scatteringConfirms protein is properly folded and suitable for downstream applications
Identity confirmationMatches predicted massMass spectrometryVerifies correct protein expression without truncations
Structural integritySecondary structure content consistent with predictionsCircular dichroismEnsures proper folding
Homogeneity>90% monodisperseSize exclusion chromatographyPrevents aggregation-related artifacts

These parameters should be verified before using recombinant YugM in functional studies to ensure reproducible and reliable results.

What are the optimal storage conditions for maintaining YugM stability and activity?

Based on standard practices for similar recombinant proteins, YugM stability can be maintained under the following conditions:

  • Short-term storage: Store at 4°C in PBS buffer for periods up to 1-2 weeks .

  • Long-term storage: Store at -20°C to -80°C, preferably in small aliquots to avoid repeated freeze-thaw cycles .

  • Buffer optimization: While PBS is the standard buffer , stability may be enhanced by adding glycerol (10-20%) or reducing agents like DTT (1 mM) if the protein contains cysteine residues.

  • Lyophilization option: For extended storage, lyophilized powder format may provide greater stability , with reconstitution immediately before use.

  • Freeze-thaw minimization: Prepare single-use aliquots to avoid protein degradation from repeated temperature cycling.

  • Activity monitoring: Implement periodic quality checks using a consistent functional assay to verify retained activity during storage.

Researchers should validate these conditions specifically for YugM through stability testing if long-term studies are planned.

How can researchers troubleshoot expression and purification challenges specific to YugM?

When encountering challenges with YugM expression and purification, researchers should systematically address issues through this troubleshooting framework:

  • Low expression yield:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (BL21(DE3), Rosetta, etc.)

    • Vary induction conditions (temperature, inducer concentration, induction time)

    • Consider using a stronger promoter or increasing copy number

  • Poor solubility:

    • Reduce expression temperature (16-20°C)

    • Co-express with chaperones

    • Test different solubility tags (MBP, SUMO, TrxA)

    • Optimize lysis buffer components (salt concentration, detergents, additives)

  • Degradation during purification:

    • Add protease inhibitors during all steps

    • Reduce processing time and temperature

    • Test N-terminal vs. C-terminal tag placement

    • Consider removing flexible regions identified by sequence analysis

  • Low purity after affinity chromatography:

    • Increase washing stringency

    • Add a second purification step (ion exchange, size exclusion)

    • Consider on-column refolding if inclusion bodies form

    • Test alternative tag systems if His-tag performance is suboptimal

  • Loss of activity:

    • Determine if the tag affects function and remove if necessary

    • Identify and maintain essential cofactors or metal ions

    • Optimize buffer conditions for stability (pH, salt, additives)

Each step should be systematically tested and documented to develop an optimized protocol specific to YugM.

What emerging technologies could accelerate the functional characterization of YugM?

Several cutting-edge technologies hold promise for accelerating YugM characterization:

  • AlphaFold2 and similar AI structure prediction tools: These can provide high-confidence structural models without crystallization, offering insights into potential functional domains and interaction surfaces.

  • CRISPR interference (CRISPRi) with titratible systems: Enables precise control of expression levels to study dosage-dependent phenotypes and genetic interactions.

  • Single-cell transcriptomics: Allows examination of cell-to-cell variation in response to YugM perturbation, potentially revealing subpopulation-specific functions.

  • High-throughput phenotyping platforms: Automated systems can test thousands of growth conditions to identify specific conditions where YugM function becomes apparent.

  • Cryo-electron tomography: Provides structural context within the native cellular environment to understand spatial organization and interactions.

  • Protein-protein interaction mapping using proximity labeling: Techniques like TurboID provide in vivo interaction landscapes with temporal resolution.

  • Metaproteomics approaches: Can reveal conservation of function across bacterial species by comparing interaction networks of homologs.

Integration of these technologies with traditional approaches will likely provide the most comprehensive understanding of YugM function.

How can researchers integrate yugM studies with broader B. subtilis systems biology?

Integration of yugM research into the broader B. subtilis systems biology landscape requires:

  • Network contextualization: Position yugM within established cellular networks (metabolic, transcriptional, protein-protein) using interaction data.

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data from yugM mutants to identify affected pathways.

  • Condition-specific analysis: Test yugM function across diverse environmental conditions to identify condition-specific roles.

  • Synthetic genetic array analysis: Perform comprehensive genetic interaction screening similar to those conducted for other y-genes in B. subtilis .

  • Mathematical modeling: Incorporate yugM data into existing B. subtilis mathematical models to predict system-wide effects of perturbation.

  • Phylogenetic profiling: Compare yugM conservation patterns with those of functionally characterized genes to predict functional associations.

  • Growth phenotype analysis: Connect yugM to cellular fitness under various conditions through quantitative growth measurements.

This integrative approach contextualizes individual gene studies within the broader cellular framework, enhancing the significance of findings.

What are the most significant unanswered questions regarding YugM function in B. subtilis?

Several critical questions remain to be addressed regarding YugM function:

  • Evolutionary conservation and specialization: How conserved is yugM across Bacillus species and what does its phylogenetic distribution suggest about its function?

  • Condition-specific essentiality: Are there specific environmental conditions under which yugM becomes essential for B. subtilis survival?

  • Genetic interaction landscape: Does yugM exhibit specific patterns of genetic interactions similar to those observed for other uncharacterized genes like ypmB, yerH, and yabM that interact with mbl ?

  • Protein interactome: What proteins directly interact with YugM and what cellular processes do these interactions affect?

  • Structural determinants of function: What structural features of YugM determine its functionality, and how do they compare to proteins of known function?

  • Regulatory context: What transcriptional or post-translational mechanisms regulate YugM expression and activity?

  • Subcellular localization: Where is YugM localized within the B. subtilis cell and does this localization change under different conditions?

  • Potential redundancy: Are there other proteins with redundant functions that mask phenotypes in yugM mutants?

Addressing these questions will significantly advance our understanding of this uncharacterized protein and potentially reveal new aspects of B. subtilis biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.