Recombinant Bacillus subtilis Uncharacterized protein yukC (yukC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our default shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
yukC; BSU31890; ESX secretion system protein YukC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yukC
Target Protein Sequence
MSGEQKSYLENQLEAVAEKTDAGYTFTFQREKIKLLDGLEANVIKDINPFFHKEIDVTDD EVIITIQPPSSYKAFRFMKAKDKKSKWQFAYQLVQAVQQHNLSRLNLIVAPENIVFDKGL TPYFLHYGVKESIPPYERDEERVWQELKAAAALAVDGAFAFEDYLKFNETLTFSAEAKAI LDAESYDDLLELIQTHIDELEAKAKTYIHIPRKKWNIQRYIGLGLIVLLVPALIYSMYAL FFAQPKHQAIVDSNRAFLNKQYSEVISTLSKYDAESLPESVQYQLATSYVEVENLGSAKT KNIENNLVTLQSDPQHFLYWIDYGRGEYKEAISIGRKLEYNDYIYFALAKYKQQLLSEDT NDEDIQKELDSVNSELEKAQKERQENKQSNSETSLVDTSEEQTQTDEEKQAEEKAAEEKA AAEEKAKKEEQKEKEDEKKETEKKDEKKDDK
Uniprot No.

Target Background

Function
Essential for YukE secretion. Likely a component or regulator of the ESX/ESAT-6-like secretion system (BsEss).
Database Links
Protein Families
EssB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of YukC in Bacillus subtilis?

YukC serves as a central membrane component of the Type VII Secretion System (T7SSb) in Bacillus subtilis, functioning as an interaction hub that contacts all T7SSb components . This protein plays a crucial role in the secretion machinery by interacting with both the WXG100 substrate YukE and the LXG effector YxiD, which are essential for bacterial competition and potentially pathogenicity . Crystal structure analysis reveals that YukC possesses unique features suggesting an intrinsic flexibility required for T7SSb antibacterial activity . The protein contains a pseudokinase domain comprising the N-terminal 216 residues that mediates interactions with other secretion system components .

How is yukC gene organized within the B. subtilis genome?

The yukC gene is located within the yuk/yue locus in the B. subtilis genome, which encodes functional components of the ESX (Type VII) protein secretion system . This gene is part of the yuk operon, which contains several genes including yukE (encoding a WXG100 family protein), yukD, yukC, yukB, yueB, and yueC . Experimental evidence shows that mutations in this operon, particularly in yukC, affect the secretion of YukE protein and impair T7SSb-mediated bacterial competition . The operon structure facilitates coordinated expression of these functionally related proteins, ensuring proper assembly and function of the T7SSb secretion machinery.

What experimental approaches are used to study YukC interaction with other proteins?

Multiple complementary approaches are employed to study YukC interactions with other T7SSb components. Bacterial two-hybrid (BACTH) assays are used to systematically investigate protein-protein interactions, revealing that YukC contacts multiple T7SSb components . Copurification assays confirm these interactions, particularly between YukC and proteins like YukB, YueB, and YukE . The interactions between YukC's pseudokinase domain and YukB's FHA region have been verified through domain mapping experiments using truncated protein constructs (such as YukCΔ217) . Additionally, crystallography provides structural insights into YukC's conformation and potential interaction surfaces . These multifaceted approaches collectively build a comprehensive understanding of YukC's role as the interaction hub within the T7SSb machinery.

How do mutations in YukC affect T7SSb function and bacterial competition?

Specific mutations in YukC, particularly P231A and H209C, significantly impact T7SSb-mediated bacterial competition capabilities . Research employing competition assays between wild-type B. subtilis and strains expressing mutant YukC variants demonstrates that these mutations impair the ability of B. subtilis to inhibit the growth of susceptible strains (such as B. subtilis Δyxid-yxxD) . The experimental approach involves complementing ΔyukC strains with either wild-type or mutant yukC genes through homologous recombination at the original locus in the yuk operon . Quantitative analysis of bacterial survival rates following competition experiments reveals that YukC's intrinsic flexibility, which is affected by these mutations, is essential for proper T7SSb antibacterial activity . These findings underscore the structure-function relationship in YukC and provide insights into the molecular mechanisms of T7SSb-mediated bacterial competition.

What methodologies are effective for recombinant expression and purification of YukC?

Recombinant expression of YukC presents several challenges due to its membrane-associated nature and role in protein secretion. Researchers typically employ E. coli expression systems with modifications to enhance membrane protein expression, such as using specialized strains (C41/C43) or fusion tags that improve solubility . For purification, a multi-step approach is recommended: initial membrane fraction isolation by ultracentrifugation, followed by detergent solubilization (typically using mild detergents like DDM or LMNG), and subsequent affinity chromatography using His-tag or other fusion tags . For structural studies requiring high purity, additional steps like size exclusion chromatography may be necessary . When expressing the pseudokinase domain alone (YukCΔ217), a more straightforward approach can be taken as this domain lacks the membrane-spanning regions and exhibits better solubility . Quality control of purified protein should include assessment of oligomeric state, as YukC has been shown to self-interact in certain contexts.

How does the crystal structure of YukC inform our understanding of T7SSb architecture?

The crystal structure of YukC reveals unique features that provide critical insights into T7SSb architecture and function . Analysis shows that YukC's pseudokinase domain adopts a conformation suggesting intrinsic flexibility, which is essential for proper T7SSb antibacterial activity . Structural comparisons with other secretion system components reveal both conserved elements and unique features that distinguish T7SSb from other secretion systems . The structural data indicate potential interaction surfaces where YukC contacts other T7SSb components, particularly at regions where the pseudokinase domain interfaces with YukB's FHA domain . These interaction sites form the molecular basis for YukC's role as the central hub of the T7SSb machinery. The structure further suggests conformational changes that may occur during the secretion process, providing a framework for understanding the dynamic nature of this secretion system and guiding future structural and functional studies of the complete T7SSb complex.

What are the key considerations for designing knockout and complementation studies of yukC?

When designing knockout and complementation studies for yukC in B. subtilis, several critical considerations must be addressed. First, researchers should employ markerless deletion strategies to minimize polar effects on downstream genes in the yuk operon . The approach documented in literature involves using erythromycin resistance cassettes flanked by lox sites (from strain BKE31890), followed by Cre recombinase-mediated excision using the thermosensitive vector pDR244 . For complementation studies, standard plasmid-based approaches often prove ineffective with yuk operon genes; instead, researchers should consider homologous recombination to reinsert yukC at its original locus . This can be achieved using non-replicative vectors like pETduet containing the yukE-yukD-yukC-yukB fragment (approximately 500 bp) and a selectable marker . The marker can later be removed using Cre-lox systems to create markerless complemented strains . When creating point mutations (such as P231A or H209C), site-directed mutagenesis should be performed on the complementation construct before chromosomal integration . Phenotypic validation should include both molecular confirmation of yukC expression and functional assays such as bacterial competition tests.

How can contradictory data on T7SSb functionality in domesticated B. subtilis strains be reconciled?

Contradictory findings regarding T7SSb functionality in domesticated B. subtilis strains can be reconciled through careful methodological considerations and experimental design. Literature shows discrepancies where some studies report functional T7SSb in domesticated strain B. subtilis 168, while others suggest non-functionality . These contradictions likely stem from differences in detection methods: monitoring YukE secretion into culture supernatants versus assessing bacterial competition activity . To resolve these inconsistencies, researchers should employ multiple complementary approaches. First, assess YukE secretion using sensitive immunoblotting with specific antibodies against recombinant full-length YukE, including appropriate lysis controls (such as detection of cytosolic SigmaA) . Second, perform direct bacterial competition assays using sensitized strains (Δyxid-yxxD) as recipients and quantifying survival rates . Third, evaluate T7SSb functionality across various growth conditions, from nutrient-rich media to nutrient-limiting conditions that promote competence and biofilm formation . Finally, perform live microscopy using fluorescent reporter strains to visualize the competition process in real-time, collecting frames at regular intervals (e.g., every 20 minutes) during overnight growth . This multi-faceted approach will provide a comprehensive assessment of T7SSb functionality and clarify apparent contradictions in the literature.

What strategies can overcome challenges in expressing recombinant YukC for structural studies?

Expressing sufficient quantities of properly folded recombinant YukC for structural studies presents significant challenges due to its membrane-associated nature. Several strategies can overcome these obstacles: (1) Expression system optimization: Using specialized E. coli strains designed for membrane proteins (C41/C43) or B. subtilis expression systems that provide a native-like membrane environment . (2) Construct design: Creating truncated versions that retain functional domains while removing problematic regions, such as the YukCΔ217 construct containing only the pseudokinase domain . (3) Fusion partners: Employing solubility-enhancing tags like MBP or SUMO, positioned strategically to avoid interfering with critical domains . (4) Expression conditions: Lowering induction temperature (16-20°C), reducing inducer concentration, and extending expression time to promote proper folding . (5) Solubilization strategy: Testing a panel of detergents (DDM, LMNG, GDN) or nanodiscs to maintain native-like environment during purification . (6) Stabilizing mutations: Introducing mutations that enhance conformational stability without affecting function, based on computational predictions . (7) Crystallization facilitators: Using antibody fragments or designed ankyrin repeat proteins (DARPins) as crystallization chaperones to stabilize flexible regions . Successful implementation of these strategies has enabled determination of YukC's crystal structure, providing crucial insights into T7SSb architecture and function.

How should researchers analyze protein-protein interaction data for YukC within the T7SSb complex?

Analysis of protein-protein interaction data for YukC requires integration of multiple experimental approaches and careful interpretation. When analyzing bacterial two-hybrid (BACTH) results, researchers should establish clear positive and negative controls, quantify β-galactosidase activity, and use statistical methods to determine significance of interactions . A comparative table should be created to visualize the interaction network:

T7SSb ComponentInteraction with YukCDetection MethodRelative StrengthConfirmation Method
YukE (WXG100)PositiveBACTHStrongCopurification
YxiD (LXG)PositiveBACTHModerateDirect binding
YukBPositiveBACTHStrongFHA domain mapping
YukDPositiveBACTHWeakCopurification
YueBPositiveBACTHModerateCopurification
YueCNegativeBACTHNoneNot applicable

For copurification data, quantitative densitometry should be employed to assess binding efficiency across different constructs and conditions . When mapping interaction domains, researchers should create a series of deletion constructs and assess minimal regions required for interaction, as demonstrated with the YukB FHA region and YukC pseudokinase domain . Integration of structural data with interaction experiments provides a comprehensive picture, allowing researchers to generate a molecular model of YukC as the interaction hub within the T7SSb complex . This multifaceted analytical approach enables reliable interpretation of protein-protein interaction data within complex bacterial secretion systems.

What comparative analyses between T7SSa and T7SSb systems provide insights into YukC function?

Comparative analyses between Type VII Secretion Systems in Actinobacteria (T7SSa) and Firmicutes (T7SSb) offer valuable insights into YukC function despite their genetic divergence . Researchers should focus on several key comparative analyses: (1) Structural comparison of secretion machinery components, noting that despite sequence divergence, WXG100 substrates show high structural similarity suggesting conserved secretion mechanisms . (2) Analysis of central hub proteins, comparing YukC from T7SSb with EccC from T7SSa, both serving as interaction hubs but with distinct molecular architectures . (3) Examination of ATP hydrolysis mechanisms, as YukC contains a pseudokinase domain while T7SSa systems utilize canonical ATPases . (4) Comparison of substrate recognition mechanisms, contrasting how YukC directly contacts substrates versus indirect recognition in T7SSa . (5) Analysis of effector delivery mechanisms, examining contact-dependent competition in B. subtilis T7SSb versus potential differences in T7SSa systems . This table summarizes key differences:

FeatureT7SSa (Actinobacteria)T7SSb (Firmicutes/B. subtilis)Implications for YukC Function
Central componentEccC (ATPase)YukC (Pseudokinase)YukC may utilize different energy coupling mechanisms
Membrane complexMulti-subunitSimpler organizationYukC plays more centralized role in T7SSb
Substrate recognitionIndirect via adaptorsDirect YukC-substrate contactYukC directly mediates substrate selection
Effector typesDiverseLXG toxins (e.g., YxiD)YukC evolved to accommodate specific effector classes
Competition mechanismVariousContact-dependentYukC structural flexibility facilitates contact-dependent delivery

These comparative analyses provide an evolutionary perspective on YukC function and guide the development of B. subtilis as a model system for T7SSb studies .

How do biochemical and genetic analyses of YukC mutations inform structure-function relationships?

Biochemical and genetic analyses of YukC mutations provide critical insights into structure-function relationships within this T7SSb component. The P231A and H209C mutations in YukC significantly impact bacterial competition capabilities without affecting protein expression or stability . These mutations were strategically selected based on structural analysis of YukC's pseudokinase domain and target residues predicted to affect conformational flexibility rather than direct substrate binding . Quantitative competition assays reveal that strains expressing YukC-P231A or YukC-H209C show reduced ability to inhibit growth of susceptible strains, with survival rates approximately 3-fold higher than with wild-type YukC . Protein interaction studies demonstrate that these mutations do not completely abolish YukC's ability to interact with other T7SSb components but alter the dynamics or strength of these interactions . Structural analysis suggests these mutations affect regions undergoing conformational changes during the secretion process rather than static interaction surfaces . The correlation between structural predictions, in vitro biochemical data, and in vivo functional assays establishes a mechanistic model where YukC's intrinsic flexibility is essential for proper T7SSb function . This integrated approach to mutation analysis exemplifies how combining structural information with functional assays can elucidate the molecular mechanisms of complex bacterial secretion systems.

What are the most promising approaches for elucidating the complete structural organization of the T7SSb complex?

Elucidating the complete structural organization of the T7SSb complex requires integrated cutting-edge approaches that address the challenges of membrane protein complexes. Cryo-electron microscopy (cryo-EM) represents the most promising primary methodology, as it can capture the intact T7SSb complex in a near-native environment without crystallization constraints . This should be complemented by cross-linking mass spectrometry (XL-MS) to identify proximity relationships between subunits, particularly at interfaces not resolved by cryo-EM . Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into dynamic regions and conformational changes during the secretion process . For membrane topology, accessibility studies using substituted cysteine accessibility method (SCAM) can map transmembrane regions of YukC and other components . Integrative structural modeling combines these experimental data with computational approaches to generate comprehensive models of the complete complex . Additionally, in situ structural approaches such as cellular cryo-electron tomography could visualize the T7SSb machinery in its native cellular context . The advantage of B. subtilis as a model system lies in its genetic tractability and the ability to create strains with modified components for structural studies, making it an ideal platform for resolving the complete T7SSb architecture .

How might targeting YukC lead to novel antimicrobial strategies against pathogenic Firmicutes?

Targeting YukC presents a promising avenue for developing novel antimicrobial strategies against pathogenic Firmicutes due to its essential role in T7SSb-mediated bacterial competition . Research suggests several potential approaches: (1) Small molecule inhibitors designed to target YukC's pseudokinase domain could disrupt its interaction with secretion substrates or other T7SSb components . (2) Peptide-based inhibitors mimicking interaction interfaces between YukC and its binding partners could competitively inhibit T7SSb assembly . (3) Structure-based drug design targeting the regions critical for YukC's intrinsic flexibility, such as the P231 and H209 residues, could impair T7SSb function without requiring complete inhibition of the protein . (4) CRISPR-Cas delivery systems could target yukC gene expression in pathogenic bacteria . (5) Exploiting the YukC-dependent secretion system to deliver antimicrobial payloads into target bacteria represents an innovative approach to overcome antimicrobial resistance . The advantage of targeting T7SSb components like YukC is that they are absent in humans but conserved across Firmicutes, potentially providing broad-spectrum activity against this bacterial phylum while minimizing off-target effects . Future research should focus on high-throughput screening assays for YukC inhibitors and in vivo validation of their efficacy in animal models of Firmicutes infections.

What techniques can best determine the spatiotemporal dynamics of YukC during T7SSb-mediated bacterial competition?

Understanding the spatiotemporal dynamics of YukC during T7SSb-mediated bacterial competition requires advanced imaging techniques combined with genetic and biochemical approaches. Super-resolution microscopy techniques such as PALM, STORM, or structured illumination microscopy can visualize fluorescently tagged YukC with nanometer precision, revealing its localization patterns during competition . Time-lapse fluorescence microscopy using strains expressing YukC-fluorescent protein fusions enables tracking of dynamic redistribution during contact with target cells, with frames collected every 20 minutes during overnight growth at 30°C as described in published protocols . FRET-based biosensors designed to detect YukC conformational changes can provide real-time information about its activation state during the competition process . Complementary approaches include time-resolved proteomics to track changes in YukC interaction partners at different stages of competition, and correlative light and electron microscopy (CLEM) to connect YukC dynamics with ultrastructural changes at the cell-cell interface . Single-molecule tracking could reveal the mobility and clustering behavior of YukC molecules during the secretion process . The B. subtilis competition assay system offers an ideal platform for implementing these approaches, as it allows controlled competition between defined attacker (wild-type) and recipient (Δyxid-yxxD) strains under conditions where T7SSb activity can be precisely monitored and manipulated .

How can researchers overcome challenges in detecting secreted effectors of the YukC-dependent T7SSb?

Detecting secreted effectors of the YukC-dependent T7SSb presents significant technical challenges due to low abundance, potential instability, and complex localization patterns. Researchers can implement several strategies to overcome these obstacles: (1) Develop highly sensitive immunodetection methods using antibodies raised against recombinant full-length effectors like YukE, with careful optimization of extraction protocols to prevent degradation . (2) Implement targeted proteomics approaches (SRM/MRM) to detect specific effector peptides in complex samples with high sensitivity and specificity . (3) Create reporter fusion constructs that maintain T7SSb recognition while enabling detection, such as minimal epitope tags or split fluorescent protein systems . (4) Optimize sample preparation by fractionating bacterial cultures into whole cell pellets, filtered culture supernatants, and concentrated proteins (via TCA precipitation) to increase detection sensitivity . (5) Employ genetic approaches using recipient strain libraries with varying sensitivities to T7SSb effectors, creating a biological detection system for secretion activity . (6) Utilize competition assays between wild-type and mutant strains as functional readouts of effector secretion, measuring survival rates under standardized conditions . Each approach has specific advantages, but the combination of molecular detection and functional assays provides the most comprehensive assessment of YukC-dependent T7SSb secretion activity.

What are effective approaches for studying YukC interactions with membrane proteins in the T7SSb complex?

Studying YukC interactions with membrane proteins in the T7SSb complex requires specialized approaches that preserve native membrane environments while enabling specific detection of interactions. Several effective methodologies include: (1) Split-protein complementation assays adapted for membrane proteins, such as the BACTH system which has successfully identified YukC interactions with multiple T7SSb components . (2) In vivo crosslinking using photo-activatable or chemical crosslinkers to capture transient interactions, followed by mass spectrometry identification . (3) Co-immunoprecipitation assays optimized for membrane proteins using mild detergents (DDM, LMNG) that maintain complex integrity during solubilization . (4) Fluorescence-based approaches including FRET and BiFC to visualize interactions in living cells, providing spatial information about interaction sites . (5) Native PAGE and blue native electrophoresis to analyze intact membrane protein complexes containing YukC . (6) Liposome reconstitution systems combining purified components to assess direct interactions in defined membrane environments . (7) Nanodiscs or styrene-maleic acid lipid particles (SMALPs) to extract membrane protein complexes with their native lipid environment for interaction studies . The combination of genetic approaches (using domain mapping as demonstrated with YukB-YukC interactions) with biochemical validation provides the most reliable characterization of YukC's extensive interaction network within the T7SSb complex .

What quality control measures ensure reliable results in recombinant YukC functional studies?

Implementing rigorous quality control measures is essential for reliable functional studies of recombinant YukC. Researchers should establish a comprehensive quality control pipeline including: (1) Expression verification through immunoblotting with anti-YukC antibodies, comparing expression levels between wild-type and mutant variants to ensure similar abundance . (2) Membrane localization assessment using fractionation protocols to confirm proper targeting of recombinant YukC to the membrane compartment . (3) Structural integrity validation through circular dichroism or limited proteolysis to verify proper folding, particularly when studying point mutations like P231A or H209C . (4) Interaction profiling to confirm that recombinant YukC maintains expected protein-protein interactions, using BACTH or copurification assays as validation . (5) Functional complementation testing, verifying that recombinant YukC restores T7SSb activity in ΔyukC strains using established competition assays . (6) Negative controls including markerless deletion strains (ΔyukC) and non-functional mutants in all experiments . (7) Positive controls using wild-type complementation strains to establish baseline activity levels . (8) Statistical validation with a minimum of three biological replicates for all functional assays . This table summarizes quality control criteria for different experimental approaches:

Experimental ApproachKey Quality Control MeasuresSuccess Criteria
Recombinant expressionSDS-PAGE, Western blotSingle band at expected MW
Membrane localizationFractionation, Western blotEnrichment in membrane fraction
Interaction studiesControl interactions, dose-responseSpecific signal above background
Competition assaysControls (ΔyukC, ΔyukE)Statistical difference from negative control
ComplementationExpression verification, functional rescueRestoration to >80% of wild-type activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.