Recombinant Bacillus subtilis Uncharacterized protein YveK (yveK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Protein YveK (yveK)

The YveK protein is essential for Bacillus subtilis growth, especially under gluconeogenic conditions, and its overproduction can rescue an mreB mutant . Bacillus subtilis is a Gram-positive bacterium known for its probiotic qualities and is frequently employed as a microbial expression system in bioengineering because of its high stress resistance, non-toxicity, and low codon preference .

YveK and its Role in Gluconeogenesis and Cell Morphology

  • Gluconeogenic Growth: YvcK is essential for the growth of Bacillus subtilis under gluconeogenic conditions .

  • mreB Mutant Rescue: Overproduction of YvcK helps rescue growth and morphology defects in the actin-like protein MreB deletion mutant by restoring PBP1 localization .

  • Phosphorylation Effects: While phosphorylation of YvcK is not required for growth on gluconeogenic conditions, it is necessary for mreB rescue .

Research Findings on YveK Phosphorylation

  • PrkC-Mediated Phosphorylation: YvcK is phosphorylated at Thr-304 by the protein kinase PrkC, and this phosphorylated form is dephosphorylated by the cognate phosphatase PrpC .

  • Bacitracin Sensitivity: Mutations affecting phosphorylation of YvcK at Thr-304 influence the sensitivity of B. subtilis to bacitracin .

  • mreB Mutant Rescue and Phosphorylation: Overproduction of YvcK T304A (a phosphorylation-deficient mutant) does not rescue the aberrant morphology of the mreB mutant due to PBP1 mislocalization. This observation is consistent in an mreB prkC double mutant overproducing YvcK .

  • Distinct Functions: YvcK has two distinct functions: one in carbon source utilization independent of its phosphorylation level and another in cell wall biosynthesis and morphogenesis that depends on its phosphorylation state .

Genetic and Genomic Context of Bacillus subtilis

  • Genome Size and Composition: The genome of Bacillus subtilis consists of one chromosome and one plasmid . The chromosome is 4,214,774 bp long, and the plasmid is 54,527 bp long .

  • Coding Genes: The genome contains 4,429 coding genes .

  • RNA Components: Bacillus subtilis contains 86 tRNAs, 27 rRNAs (9 16S_rRNA, 9 23S_rRNA, and 9 5S_rRNA), and 114 other ncRNAs .

  • Functional Annotations: Genes in Bacillus subtilis are associated with various metabolic processes, including amino acid biosynthesis, carbon metabolism, purine and pyrimidine metabolism, and ABC transporters . They are also related to nucleic acid binding transcription factor activity, transporter activity, antioxidant activity, and biological adhesion .

  • Enzymatic Activities: Bacillus subtilis possesses glycoside hydrolases, glycosyltransferases, polysaccharide lyases, carbohydrate esterases, auxiliary activities, and carbohydrate-binding modules .

Recombinant Production and Availability

  • Recombinant Protein: Recombinant forms of uncharacterized proteins from Bacillus subtilis, including YveK, are available for research purposes .

  • Expression Hosts: Recombinant YveK can be produced in E. coli .

  • Purity: Recombinant proteins are typically produced with a purity level greater than 85% as determined by SDS-PAGE .

  • Storage and Handling: Recombinant proteins should be stored at -20 degrees C, with long-term storage at -20 degrees C or -80 degrees C. Repeated freezing and thawing is not recommended .

Potential Applications and Significance

  • Probiotic Applications: Understanding the genetic properties of Bacillus subtilis can improve public awareness and provide a theoretical basis for developing probiotic products .

  • Antibiotic Resistance: Research into proteins like YvcK can provide insights into antibiotic resistance mechanisms .

  • Industrial Applications: Due to its high stress resistance, non-toxicity, and low codon preference, Bacillus subtilis is a promising microbial expression system in bioengineering .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yveK; BSU34370; Uncharacterized protein YveK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yveK
Target Protein Sequence
MNENMSFKELYAIVRHRFVLILLITIGVTLIMGFVQFKVISPTYQASTQVLVHESDGEEN SNLSDIQRNLQYSSTFQSIMKSTALMEEVKAELHLSESASSLKGKVVTSSENESEIINVA VQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAKASESPMIKPARLRNMVMAFG AAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVHKGRNRGIKHFGE
Uniprot No.

Target Background

Database Links
Protein Families
CpsC/CapA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YveK protein in Bacillus subtilis?

YveK is a protein encoded in the genome of Bacillus subtilis, a rod-shaped, Gram-positive bacterium primarily found in soil, air, and decomposing plant matter . As part of the B. subtilis proteome, YveK belongs to the category of proteins whose biological functions remain incompletely characterized. Preliminary sequence analysis suggests potential involvement in stress response pathways, though experimental validation is still needed. Like many B. subtilis proteins, YveK exists within a complex cellular environment capable of endospore formation and adaptation to diverse environmental conditions .

Why is YveK considered an "uncharacterized" protein?

YveK bears the "uncharacterized" designation because its biochemical function, cellular localization, interaction partners, and role in biological pathways remain experimentally unverified. While bioinformatic predictions may suggest potential functions based on sequence homology or structural features, these predictions require experimental validation. The methodological approach to characterizing such proteins follows a systematic progression from sequence analysis through structural studies to functional assays. Proteins often retain the "uncharacterized" label until multiple independent experimental approaches confirm their function, particularly challenging for proteins like YveK that may have context-dependent functions or subtle phenotypic effects when disrupted.

What are the best experimental approaches to determine YveK subcellular localization?

Determining YveK's subcellular localization requires multiple complementary approaches:

  • Fluorescent protein fusion analysis: Construction of N- and C-terminal GFP/mCherry fusions with YveK expressed from native or inducible promoters in B. subtilis. Microscopic visualization during different growth phases and stress conditions can reveal dynamic localization patterns.

  • Immunolocalization: Generation of specific antibodies against purified recombinant YveK for immunofluorescence microscopy, offering validation independent of fusion constructs.

  • Subcellular fractionation: Physical separation of B. subtilis cellular components (membrane, cytoplasm, cell wall) followed by Western blot analysis to detect native YveK.

  • Proteomic profiling: Large-scale proteomic analysis of purified subcellular fractions to identify YveK enrichment.

Each method has distinct advantages and limitations; therefore, convergent evidence from multiple approaches provides the most reliable localization determination. Integration with genomic context analysis and comparison with expression patterns of co-localized proteins can provide additional functional insights .

How does YveK expression change during Bacillus subtilis growth phases?

Characterizing YveK expression across B. subtilis growth phases requires temporal analysis:

  • Transcriptomic profiling: RNA-Seq or qRT-PCR analysis of samples collected at defined time points across growth phases (lag, exponential, transition, stationary, and sporulation) under standardized conditions.

  • Promoter activity measurements: Construction of yveK promoter-reporter fusions (luciferase or fluorescent proteins) for real-time expression monitoring.

  • Western blot analysis: Quantification of YveK protein levels at corresponding time points using specific antibodies.

  • Integration with regulon data: Comparison of YveK expression patterns with known regulatory networks associated with growth phase transitions, particularly those related to sporulation, which represents a complex developmental program in B. subtilis .

Expression changes should be analyzed in both standard laboratory media and under various stress conditions, as many uncharacterized proteins show condition-specific expression patterns that provide clues to their function.

What bioinformatic approaches provide initial insights into potential YveK function?

Initial bioinformatic characterization of YveK should employ a multi-layered approach:

  • Sequence-based analyses:

    • Homology detection using sensitive profile methods (PSI-BLAST, HHpred)

    • Identification of conserved domains and motifs via InterPro and PROSITE

    • Transmembrane region and signal peptide prediction (TMHMM, SignalP)

    • Structural disorder analysis (PONDR, IUPred)

  • Genomic context analysis:

    • Operonic structure examination

    • Conservation of genomic neighborhood across bacterial species

    • Co-occurrence patterns with genes of known function

  • Structural prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Tertiary structure modeling (AlphaFold2, RoseTTAFold)

    • Functional site prediction based on structural features

These computational approaches generate testable hypotheses that guide subsequent experimental design, particularly for proteins like YveK where limited prior experimental data exists. The combination of sequence, structural, and genomic context information often provides complementary insights that single approaches might miss.

What expression systems are most effective for recombinant YveK production?

Optimizing recombinant YveK production requires systematic evaluation of expression systems:

  • E. coli-based expression:

    • BL21(DE3) or derivatives for T7-based expression

    • Arctic Express strains for expression at lower temperatures

    • SHuffle strains if disulfide bonds are predicted

  • B. subtilis expression:

    • Modified chassis strains with reduced autolysis and enhanced biomass production

    • Integration into the amyE locus for stable expression

    • SURE expression system for controlled induction

  • Alternative hosts:

    • Lactococcus lactis for membrane proteins

    • Pichia pastoris for proteins requiring eukaryotic processing

The experimental approach should include optimization of:

  • Induction conditions (temperature, inducer concentration, timing)

  • Media composition and growth parameters

  • Codon optimization for the selected host

  • N- and C-terminal boundaries to enhance solubility

The design-build-test framework employed for B. subtilis chassis cell engineering provides an excellent template for systematic optimization of expression conditions.

What purification challenges are specific to YveK and how can they be overcome?

Purification of uncharacterized proteins like YveK presents specific challenges that require methodical troubleshooting:

  • Solubility issues:

    • Screen buffer conditions systematically (pH 5.5-8.5, salt 50-500 mM)

    • Evaluate detergents if membrane association is suspected

    • Consider fusion partners (MBP, SUMO) that enhance solubility

  • Stability concerns:

    • Implement thermal shift assays to identify stabilizing conditions

    • Include protease inhibitors throughout purification

    • Optimize storage conditions (glycerol percentage, reducing agents)

  • Purity assessment:

    • Multiple orthogonal techniques (SDS-PAGE, size exclusion chromatography, mass spectrometry)

    • Activity assays if candidate functions are identified

    • Evaluation of oligomeric state by native PAGE or light scattering

  • Scale-up considerations:

    • Transition from batch to chromatographic methods

    • Process optimization to maintain activity during concentration steps

The protease resistance assay methodology developed for protein stability assessment could be adapted to rapidly screen conditions that enhance YveK stability during purification.

How can researchers determine if purified recombinant YveK is properly folded?

Assessing proper folding of purified YveK requires multiple analytical approaches:

  • Spectroscopic methods:

    • Circular dichroism (CD) to evaluate secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure organization

    • NMR spectroscopy for more detailed structural characterization

  • Hydrodynamic techniques:

    • Size exclusion chromatography to confirm monodispersity

    • Dynamic light scattering to detect aggregation

    • Analytical ultracentrifugation for detailed oligomeric state analysis

  • Functional indicators:

    • Thermal stability compared to predictions

    • Ligand binding if potential partners are identified

    • Resistance to limited proteolysis

  • Comparative analysis:

    • Comparison with computational structural predictions

    • Evaluation of similar proteins with known folding properties

The parallel protein stability assessment approach described in the literature demonstrates how systematic evaluation using multiple metrics provides more reliable folding assessment than any single method alone.

What fusion tags are optimal for YveK expression and why?

Fusion tag selection for YveK should be guided by experimental objectives:

TagSizeAdvantagesDisadvantagesBest Used For
His60.8 kDaMinimal size, compatible with denaturing conditionsLimited solubility enhancementInitial screening, structural studies
GST26 kDaEnhances solubility, facilitates detectionLarge size may affect functionSolubility enhancement, pull-down assays
MBP40 kDaStrong solubility enhancement, affinity purificationVery large sizeDifficult-to-express proteins
SUMO11 kDaEnhances solubility, precise cleavageRequires specific proteaseStructural studies requiring tag removal
FLAG/HA<1 kDaMinimal interference, good antibodies availableLimited purification efficiencyCo-immunoprecipitation, localization studies

The methodological approach involves:

  • Constructing multiple tagged variants in parallel

  • Comparing expression levels, solubility, and purification yields

  • Assessing impact on activity if functional assays are available

  • Evaluating tag removal efficiency if required for downstream applications

The protease resistance assay methodology could be adapted to efficiently compare stability and folding of different tagged constructs.

How can researchers overcome challenges in expressing YveK in heterologous hosts?

Addressing heterologous expression challenges for YveK requires systematic optimization:

  • Codon optimization:

    • Adapt codon usage to expression host preferences

    • Remove rare codons and unfavorable codon combinations

    • Optimize GC content and mRNA secondary structure

  • Expression construct design:

    • Test multiple N- and C-terminal boundaries

    • Evaluate position effects of fusion tags

    • Consider domain-based construct design if multi-domain

  • Expression conditions:

    • Vary induction parameters (OD₆₀₀, inducer concentration, temperature)

    • Test specialized media formulations

    • Evaluate co-expression with chaperones

  • Host strain selection:

    • For B. subtilis expression, consider engineered chassis strains with enhanced biomass production and reduced autolysis

    • For E. coli, evaluate specialized strains for problematic proteins

The lifespan engineering approach described for B. subtilis chassis strain development demonstrates how systematic genetic modifications can dramatically improve heterologous protein expression by creating more robust cellular environments.

What structural biology techniques are most suitable for YveK characterization?

Structural characterization of YveK should employ complementary techniques:

  • X-ray crystallography:

    • Requires high-purity protein (>95%) and milligram quantities

    • Systematic screening of crystallization conditions

    • May require surface engineering to enhance crystallizability

  • NMR spectroscopy:

    • Most suitable if YveK is <30 kDa or can be studied as domains

    • Requires isotopic labeling (¹⁵N, ¹³C, ²H)

    • Provides dynamics information not available from crystallography

  • Cryo-electron microscopy:

    • Particularly valuable for larger assemblies

    • Minimal sample preparation compared to crystallography

    • Recent advances allow near-atomic resolution

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution envelope information

    • Works in solution without crystallization

    • Complements higher-resolution techniques

  • Computational structure prediction:

    • AlphaFold2 or RoseTTAFold can provide initial models

    • Requires experimental validation

The protein folding analysis methodology demonstrates how integrating computational prediction with experimental validation provides more reliable structural insights than either approach alone.

How can researchers identify potential interaction partners of YveK?

Investigating YveK protein-protein interactions requires multi-faceted approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Expression of tagged YveK in B. subtilis

    • Crosslinking to stabilize transient interactions

    • Affinity purification followed by MS identification

    • Quantitative comparison with control pulldowns

  • Yeast two-hybrid or bacterial two-hybrid screening:

    • Construction of YveK bait plasmids

    • Screening against B. subtilis genomic libraries

    • Validation of hits by reciprocal screening

  • In vitro binding assays:

    • Surface plasmon resonance or biolayer interferometry

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for solution-based measurements

  • Proximity labeling approaches:

    • BioID or APEX2 fusions to YveK

    • Expression in B. subtilis under native conditions

    • Identification of labeled proteins by MS

These techniques should be applied under various growth conditions, particularly during stress responses where YveK may have condition-specific interaction partners.

What genetic approaches can help determine YveK function?

Genetic dissection of YveK function requires systematic manipulation:

  • Gene deletion and complementation:

    • Clean deletion using Cre/lox system as described for chassis strain construction

    • Phenotypic characterization under diverse conditions

    • Complementation with wild-type and mutant alleles

  • Conditional expression systems:

    • Depletion studies if yveK is essential

    • Controlled overexpression to identify gain-of-function phenotypes

    • Inducible expression for temporal studies

  • Domain mapping:

    • Construction of truncation series

    • Domain swapping with homologous proteins

    • Site-directed mutagenesis of predicted functional residues

  • Synthetic genetic interactions:

    • Systematic double mutant construction

    • Suppressor screens to identify compensatory mutations

    • Integration with chassis strain backgrounds to reveal masked phenotypes

The systematic approach to genetic manipulation employed in the B. subtilis chassis strain engineering provides an excellent methodological framework for genetic dissection of YveK function.

How can researchers assess if YveK is involved in stress response pathways?

Investigating YveK's potential role in stress response requires multi-level analysis:

  • Expression profiling under stress conditions:

    • Quantitative RT-PCR or RNA-Seq under various stressors:

      • Heat shock (42-55°C)

      • Oxidative stress (H₂O₂, paraquat)

      • Osmotic stress (NaCl, sorbitol)

      • Nutrient limitation

      • Cell wall/membrane stress (antibiotics)

  • Stress sensitivity phenotyping:

    • Survival/growth curves of yveK mutants under stress

    • Microscopic analysis of cellular morphology during stress

    • Recovery rates post-stress exposure

    • Competitive fitness in mixed cultures during stress

  • Molecular response analysis:

    • Phosphoproteomics to detect stress-induced YveK modifications

    • Chromatin immunoprecipitation to identify regulators binding yveK promoter

    • Epistasis analysis with known stress response regulators

This approach aligns with B. subtilis stress response characterization methods and can reveal whether YveK functions as a sensor, signal transducer, or effector in specific stress response pathways.

What biochemical assays can help determine YveK enzymatic activity?

Elucidating potential YveK enzymatic function requires systematic activity screening:

  • Informed activity hypothesis testing:

    • Design assays based on bioinformatic predictions

    • Test activities of characterized homologs if available

    • Focus on biochemical pathways suggested by genetic phenotypes

  • Substrate screening approaches:

    • Metabolite arrays for potential enzymatic substrates

    • Differential scanning fluorimetry to detect ligand binding

    • Activity-based protein profiling with mechanism-based probes

  • Enzyme kinetics characterization:

    • Determination of reaction velocities across substrate concentrations

    • Calculation of kinetic parameters (Km, kcat, kcat/Km)

    • Inhibition studies to probe mechanism

  • Cofactor requirements analysis:

    • Metal dependency (EDTA chelation, metal reconstitution)

    • Coenzyme requirements (NAD(P)H, FAD, PLP, etc.)

    • pH and temperature optima determination

Each assay should include appropriate positive and negative controls, with careful attention to buffer conditions that maintain YveK stability as determined during purification optimization.

How can CRISPR-Cas9 be utilized for precise editing of the yveK gene in B. subtilis?

CRISPR-Cas9 editing of yveK in B. subtilis requires a methodological approach:

  • Design phase:

    • sgRNA design targeting specific yveK regions (NGG PAM sites)

    • Off-target analysis using B. subtilis genome

    • Design of repair templates incorporating desired mutations

    • Selection of appropriate Cas9 variant (SpCas9, nickase variants)

  • Vector construction:

    • Assembly of CRISPR components in B. subtilis-compatible vectors

    • Inducible Cas9 expression to reduce toxicity

    • Verification of constructs by sequencing

  • Transformation and selection:

    • Optimization of transformation efficiency

    • Selection strategy for edited cells

    • Screening methods to identify successful edits

  • Validation phase:

    • Sequencing confirmation of intended modifications

    • Phenotypic characterization of edited strains

    • Complementation to verify phenotype specificity

The knockout method described for chassis strain construction using the Cre/lox system provides a foundation that can be adapted for CRISPR-based approaches, particularly in terms of transformation protocols and selection strategies.

How does YveK expression change in engineered B. subtilis chassis strains?

Analyzing YveK expression in engineered chassis strains:

  • Selection of relevant chassis backgrounds:

    • Autolysis-resistant strains (knockouts in genes like lytC, sigD, pcfA)

    • Prophage-deleted strains

    • Sporulation-deficient strains (spo0A mutants)

  • Expression analysis methodology:

    • Quantitative RT-PCR targeting yveK

    • Western blotting with YveK-specific antibodies

    • Transcriptomics to place YveK in context of global expression changes

  • Correlation analysis:

    • Growth phase correlation in chassis vs. wild-type backgrounds

    • Response to stress conditions in different genetic backgrounds

    • Relationship to phenotypic characteristics of chassis strains

The lifespan engineering approach described for B. subtilis chassis strain development demonstrates how systematic genetic modifications can alter expression patterns of many genes, potentially including or affecting yveK regulation.

How can high-throughput screening methods be applied to study YveK function?

Implementing high-throughput approaches for YveK functional analysis:

  • Chemical genetic screening:

    • Exposure of yveK mutants to compound libraries

    • Identification of synthetic lethal or suppressive interactions

    • Pathway mapping based on chemical sensitivities

  • Phenotypic microarrays:

    • Testing growth of yveK mutants across hundreds of conditions

    • Identification of condition-specific growth defects

    • Metabolic profiling under various nutrient sources

  • Massively parallel genetic interaction mapping:

    • CRISPR interference library screening in yveK backgrounds

    • Transposon sequencing (Tn-Seq) in yveK mutants

    • Synthetic genetic array analysis with yveK as query

  • Parallel protein interaction screening:

    • Adapting protein stability measurement techniques to screen for YveK-interacting proteins

    • Massively parallel yeast two-hybrid screening

    • Protein complementation assays with fragment libraries

These approaches generate large datasets that require sophisticated computational analysis but can rapidly accelerate understanding of YveK function by identifying patterns across hundreds or thousands of conditions.

How can lifespan engineering approaches help elucidate YveK function?

Applying lifespan engineering concepts to YveK research:

  • Integration with chassis strain platforms:

    • Expression of YveK variants in engineered backgrounds

    • Analysis of synthetic interactions with autolysis genes

    • Evaluation of YveK contribution to chassis strain properties

  • Manipulation of YveK in stress response contexts:

    • YveK modification in strains with altered stress response pathways

    • Analysis of cellular aging parameters with YveK variants

    • Determination of YveK's role in cellular longevity

  • Industrial application assessment:

    • Evaluation of YveK modifications on recombinant protein production

    • Testing YveK variants in bioproduction contexts

    • Integration with established chassis optimization parameters

What proteomics approaches can reveal post-translational modifications of YveK?

Characterizing YveK post-translational modifications:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics for identification of modification sites

    • Top-down proteomics for intact protein analysis

    • Targeted methods for specific modifications:

      • Phosphoproteomics (IMAC, TiO₂ enrichment)

      • Glycoproteomics (lectin affinity, hydrazide chemistry)

      • Redox proteomics (thiol trapping, diagonal electrophoresis)

  • Temporal dynamics analysis:

    • Modification changes during growth phases

    • Stress-induced modification patterns

    • Cell cycle-dependent modifications

  • Functional significance assessment:

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic and phosphodeficient mutations

    • In vitro modification using purified enzymes

  • Modification crosstalk analysis:

    • Multiple reaction monitoring for combinatorial modifications

    • Correlation between different modification types

    • Pathway inhibition to track modification dependencies

These approaches can reveal regulatory mechanisms controlling YveK function and place it within signaling networks responding to environmental conditions.

What controls should be included in YveK functional assays?

Robust YveK functional assays require comprehensive controls:

  • Negative controls:

    • Buffer-only controls for biochemical assays

    • Empty vector or irrelevant protein for expression studies

    • Wild-type strain compared to yveK knockout for phenotypic assays

    • Scrambled peptides or proteins for interaction studies

  • Positive controls:

    • Known proteins with similar predicted functions

    • Complemented strain expressing wild-type YveK

    • Synthetic substrates for predicted enzymatic activities

  • Validation controls:

    • Concentration gradients to establish dose-dependency

    • Time-course measurements for kinetic analysis

    • Multiple technical and biological replicates

    • Independent methodologies confirming key findings

The protein stability measurement approach demonstrates the importance of appropriate controls, including the use of scrambled sequences to establish baseline measurements and known proteins to validate assay performance.

How can researchers resolve conflicting data about YveK function?

Addressing conflicting YveK functional data:

  • Methodological reconciliation:

    • Detailed comparison of experimental conditions

    • Assessment of strain background differences

    • Evaluation of reagent quality and specificity

    • Statistical reanalysis with consistent methods

  • Integrative approaches:

    • Orthogonal experimental validation

    • Comprehensive models accounting for context-dependency

    • Meta-analysis of multiple datasets

  • Conditional dependencies investigation:

    • Testing function under varied growth conditions

    • Analysis of genetic background effects

    • Evaluation of media composition influences

    • Temperature and pH dependency assessment

The systematic approach to protein characterization exemplified in the chassis strain engineering research demonstrates how careful control of experimental variables can resolve apparently conflicting results by identifying specific conditions where phenotypes manifest.

What statistical approaches are most appropriate for analyzing YveK functional data?

Statistical analysis of YveK functional data:

  • Experimental design considerations:

    • Power analysis to determine sample size requirements

    • Randomization and blinding where applicable

    • Balanced design for factorial experiments

    • Appropriate technical and biological replication

  • Data analysis methods:

    • Parametric tests when assumptions are met (t-tests, ANOVA)

    • Non-parametric alternatives when appropriate (Mann-Whitney, Kruskal-Wallis)

    • Multiple testing correction (Bonferroni, Benjamini-Hochberg)

    • Effect size calculation beyond p-value reporting

  • Advanced statistical approaches:

    • Regression models for continuous responses

    • Mixed-effects models for nested designs

    • Survival analysis for time-to-event data

    • Bayesian methods for integrating prior knowledge

The statistical methodology employed in the protein stability assessment study , which included careful modeling of complete selection procedures and parameterization using control sequences, exemplifies sophisticated statistical approaches for extracting reliable information from complex experimental data.

How should researchers approach reproducibility challenges with YveK?

Addressing reproducibility in YveK research:

  • Standardization practices:

    • Detailed standard operating procedures (SOPs)

    • Consistent strain maintenance protocols

    • Reagent validation and quality control

    • Instrument calibration and maintenance

  • Data management:

    • Comprehensive electronic laboratory notebooks

    • Raw data preservation and accessibility

    • Detailed metadata documentation

    • Version control for analysis scripts

  • Collaborative validation:

    • Inter-laboratory reproducibility testing

    • Blind sample analysis

    • Third-party verification of key findings

    • Pre-registered experimental designs

The systematic approach to chassis strain development demonstrates good reproducibility practices, including detailed documentation of strain construction methods, clear reporting of growth conditions, and quantitative measurement of phenotypes.

What are the best practices for reporting YveK characterization in scientific publications?

Best practices for reporting YveK characterization:

  • Methods transparency:

    • Complete strain construction details

    • Full experimental protocols with all parameters

    • Statistical analysis methods specification

    • Software versions and parameters

  • Results completeness:

    • Presentation of both supporting and contradictory data

    • Raw data availability in repositories

    • Effect sizes with confidence intervals

    • Limitations acknowledgment

  • Material sharing:

    • Strain deposition in public collections

    • Plasmid sharing through repositories

    • Antibody validation and availability

    • Analysis code sharing on platforms like GitHub

  • Contextual integration:

    • Relationship to existing literature

    • Alternative interpretations discussion

    • Implications for broader B. subtilis biology

    • Specific follow-up experiments suggestion

Following the comprehensive reporting approach demonstrated in the chassis strain engineering research and protein stability analysis , where methods, materials, and analyses were described in sufficient detail to enable reproduction, ensures that YveK characterization contributes meaningfully to scientific advancement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.