Recombinant Bacillus subtilis Uncharacterized protein yvlA (yvlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yvlA; BSU35130; Uncharacterized protein YvlA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvlA
Target Protein Sequence
MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIA LLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yvlA protein from Bacillus subtilis?

The yvlA protein (UniProt ID: O34322) is an uncharacterized protein from Bacillus subtilis consisting of 108 amino acids. It is also known by the synonyms BSU35130 and Uncharacterized protein YvlA . Based on its amino acid sequence and computational predictions, it appears to be a membrane-associated protein with multiple transmembrane domains. Despite being identified in the Bacillus subtilis genome, its precise biological function remains undetermined, making it a target for functional genomics studies.

How is recombinant yvlA protein typically expressed for research purposes?

Recombinant yvlA is typically expressed as a fusion protein with an N-terminal His-tag in E. coli expression systems. The full-length sequence (amino acids 1-108) has been successfully expressed using this approach . The His-tag facilitates purification using metal affinity chromatography while minimally affecting protein structure. Alternative expression hosts may include:

Expression SystemAdvantagesChallenges
E. coliHigh yield, rapid growth, well-established protocolsPotential for inclusion bodies with membrane proteins
B. subtilisNative environment, potential for proper foldingLower yields, more complex genetic manipulation
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, potentially lower yield

What experimental approaches are recommended for determining the function of uncharacterized proteins like yvlA?

For uncharacterized proteins like yvlA, a multi-faceted approach is recommended:

  • Bioinformatic analysis: Begin with sequence homology searches, structural predictions, and genomic context analysis. For yvlA, its genomic context in B. subtilis could provide clues about potential functional pathways.

  • Phenotypic characterization of knockout mutants: Create a yvlA deletion strain in B. subtilis and compare its phenotype to wild-type under various conditions (stress, nutrient limitation, stationary phase).

  • Protein-protein interaction studies: Techniques like bacterial two-hybrid systems, co-immunoprecipitation, or pull-down assays using purified His-tagged recombinant yvlA can identify potential binding partners.

  • Transcriptional analysis: Examining expression patterns of yvlA under different conditions. Interestingly, while yvlA is uncharacterized, research on other B. subtilis genes has shown that some promoters (like P ylb) exhibit very high activity during the stationary phase . Understanding when yvlA is expressed could provide functional insights.

  • Subcellular localization: Fluorescent tagging of yvlA to determine its location within the bacterial cell.

How can researchers verify successful expression and purification of recombinant yvlA protein?

Verification should follow a systematic approach:

  • SDS-PAGE analysis: Confirms the presence of a protein band at the expected molecular weight (~12 kDa plus the His-tag). Multiple samples should be collected during expression and purification for comparison.

  • Western blotting: Using anti-His antibodies to specifically detect the His-tagged yvlA protein.

  • Mass spectrometry: For definitive identification and sequence verification of the purified protein.

  • Purity assessment: A purity greater than 90% as determined by SDS-PAGE should be achieved for most research applications .

  • Functional verification: If preliminary functional hypotheses exist, activity assays should be developed.

What structural analyses would provide insights into yvlA's potential function?

Several structural biology approaches could illuminate yvlA's function:

  • Circular dichroism (CD) spectroscopy: To determine secondary structure composition (α-helices vs. β-sheets).

  • X-ray crystallography: For atomic-resolution structure, requiring purified protein crystals.

  • Nuclear magnetic resonance (NMR) spectroscopy: Useful for smaller proteins like yvlA (108 aa) to determine structure in solution.

  • Cryo-electron microscopy: Particularly if yvlA functions as part of a larger complex.

  • Computational structure prediction: Tools like AlphaFold can provide structural models based on the amino acid sequence, which can guide hypothesis generation regarding function.

What are the optimal conditions for expressing and purifying His-tagged yvlA protein?

Based on current protocols for recombinant yvlA:

  • Expression system: E. coli has been successfully used for expression with N-terminal His tag .

  • Induction parameters: For membrane proteins like yvlA, lower induction temperatures (16-25°C) and reduced inducer concentrations often improve proper folding.

  • Lysis and extraction: Due to yvlA's hydrophobic nature, detergent-based extraction may be necessary. Common detergents include n-dodecyl β-D-maltoside (DDM) or CHAPS.

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Consider including detergents in all purification buffers

    • A second purification step (size exclusion or ion exchange) may improve purity

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses. Avoid repeated freeze-thaw cycles .

How should researchers reconstitute and handle purified yvlA protein for experimental use?

For optimal handling of purified yvlA:

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage considerations:

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing should be avoided

    • Storage buffer typically contains Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Quality control: Monitor protein stability via SDS-PAGE before critical experiments.

What approaches can be used to investigate potential membrane association of yvlA?

Given the hydrophobic profile of yvlA's amino acid sequence, several approaches can verify and characterize its membrane association:

  • Membrane fractionation: Separate B. subtilis cellular components to determine yvlA's localization.

  • Protease protection assays: To determine topology of membrane-inserted yvlA.

  • Fluorescent protein fusion: Creating yvlA-GFP fusions for in vivo localization studies.

  • Liposome reconstitution: Inserting purified yvlA into artificial lipid bilayers to study its behavior.

  • Computational prediction tools: Transmembrane domain predictors like TMHMM or Phobius to guide experimental design.

How can the stationary phase expression systems in B. subtilis be leveraged for studying yvlA?

Recent research has identified highly efficient stationary phase promoters in B. subtilis, such as P ylb, which exhibits very high activity during the stationary phase of growth but low activity in log phase . While this refers to ylb rather than yvlA, these findings suggest methodological approaches:

  • Expression timing: Investigate whether yvlA's native expression correlates with growth phases in B. subtilis.

  • Promoter engineering: If studying yvlA function requires controlled expression, consider using identified strong stationary phase promoters.

  • Comparative analysis: Compare yvlA expression with other stationary phase-induced genes to identify potential functional relationships.

  • Regulatory network mapping: Use quantitative PCR analyses similar to those that identified P ylb's activity to determine factors regulating yvlA expression .

What bioinformatic tools are most effective for predicting potential functions of uncharacterized proteins like yvlA?

For uncharacterized proteins like yvlA, a comprehensive bioinformatic workflow includes:

  • Sequence homology searches:

    • BLASTp against protein databases

    • Hidden Markov Model (HMM) searches using HMMER

    • Position-Specific Iterated BLAST (PSI-BLAST) for distant homologs

  • Domain and motif identification:

    • InterPro for domain identification

    • PROSITE for functional motifs

    • SignalP for signal peptide prediction

  • Structural prediction:

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • PSIPRED for secondary structure prediction

  • Genomic context analysis:

    • Examination of gene neighborhood in B. subtilis genome

    • Identification of conserved operons across species

  • Co-expression network analysis:

    • Mining of B. subtilis transcriptomic datasets to identify genes co-expressed with yvlA

How can researchers design experiments to elucidate the role of yvlA in B. subtilis physiology?

A systematic experimental design would include:

  • Gene knockout and complementation:

    • Create a clean yvlA deletion strain

    • Perform phenotypic characterization under various conditions (different carbon sources, stress conditions, etc.)

    • Complement with wild-type yvlA to verify phenotype rescue

  • Controlled expression studies:

    • Overexpress yvlA using inducible promoters

    • Observe phenotypic changes upon overexpression

    • Consider utilizing the highly efficient P ylb promoter system for stationary phase expression

  • Protein localization:

    • Create fluorescent protein fusions to determine subcellular localization

    • Perform time-lapse microscopy to monitor localization changes during growth phases

  • Interactome mapping:

    • Perform pull-down assays with His-tagged yvlA

    • Identify interacting partners via mass spectrometry

    • Verify interactions with reciprocal pull-downs or bacterial two-hybrid systems

What are common challenges in expressing and purifying membrane-associated proteins like yvlA?

Membrane proteins like yvlA present several challenges:

  • Expression toxicity: Overexpression may cause membrane stress and reduce cell viability.

    • Solution: Use tightly regulated promoters and lower induction levels.

  • Inclusion body formation:

    • Solution: Reduce expression temperature (16-18°C), use solubility-enhancing fusion tags, or optimize codon usage.

  • Detergent selection challenges:

    • Solution: Screen multiple detergents (DDM, CHAPS, OG) for extraction efficiency and protein stability.

  • Protein instability after purification:

    • Solution: Optimize buffer conditions (pH, salt, additives) and include stabilizers like glycerol or trehalose .

  • Low yield:

    • Solution: Scale up culture volume, optimize induction parameters, or consider alternative expression hosts.

How can researchers address difficulties in determining the function of uncharacterized proteins?

The functional characterization of uncharacterized proteins requires a persistent, multi-faceted approach:

  • Start with the most reliable predictions: Focus initial experiments on testing the most confident bioinformatic predictions.

  • Design robust negative controls: Include proper controls to avoid misinterpreting non-specific effects.

  • Utilize chemical genomics: Screen for compounds that show differential effects on wild-type versus yvlA knockout strains.

  • Consider evolutionary context: Examine the presence/absence of yvlA homologs across bacterial species and correlate with known phenotypic differences.

  • Develop medium-throughput phenotypic assays: Test growth under hundreds of conditions using approaches like Biolog plates or custom stress panels.

  • Be prepared for unexpected functions: Many proteins perform roles different from their bioinformatic predictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.