Recombinant Bacillus subtilis Uncharacterized protein ywaF (ywaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
ywaF; BSU38440; ipa-11d; Uncharacterized protein YwaF; ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywaF
Target Protein Sequence
MQKYVQSDYKHDPFHLFSTEHVVTLAIISLLAILLFLFQDEVKQPRASRFLRSLFVFLLL GSQIGYQIWMVATDRWSVRTSLPLQLSDLSVYLSAIMLVTKSRKLFVFLFFVGIGSSIQA LATPDLGMFSFPHIRYILFFISHGSVFLSCLLMAVIGTYRMGQRSLWVTVLLVNVYGVCI FLIDRWLGANYMYLTKKPGGSSLLDVLGPWPWYIVSAEAITIASFFILYWLYRIFKK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches should be used to characterize the unknown function of ywaF protein in Bacillus subtilis?

The characterization of uncharacterized proteins like ywaF requires a multi-faceted approach. Begin with sequence-based bioinformatic analysis to identify conserved domains and potential homologs in related species. Follow with recombinant expression and purification using methods similar to those employed for other B. subtilis proteins. For instance, the overlapping yaaG and yaaF genes were successfully cloned and overexpressed in Escherichia coli, with subsequent purification revealing that yaaG encoded a homodimeric deoxyguanosine kinase and yaaF encoded a homodimeric deoxynucleoside kinase . Similar strategies can be applied to ywaF.

For functional characterization, employ enzyme activity assays testing common biochemical reactions, protein-protein interaction studies, and structural analysis via X-ray crystallography or NMR spectroscopy. Generate gene knockout strains to observe phenotypic changes under various growth conditions. Transcriptomic and proteomic analyses can provide context for expression patterns and potential functional networks.

How is gene knockout of ywaF performed in Bacillus subtilis, and what controls should be included?

Gene knockout of ywaF in B. subtilis should follow established protocols for this organism. Based on successful approaches with other genes, a recommended method involves PCR amplification of flanking sequences of ywaF, followed by insertion of an antibiotic resistance cassette without promoter and transcriptional terminators . For example, when creating a knockout of yvcJ in B. subtilis, researchers amplified flanking sequences using specific primers, then ligated these sequences with either a chloramphenicol or tetracycline resistance cassette before transformation into B. subtilis strain 168 .

Essential controls include:

  • Wild-type strain grown under identical conditions

  • Complementation strain where ywaF is reintroduced on a plasmid or at an ectopic chromosomal location

  • Empty vector controls for complementation studies

  • Knockout of a gene with known function as a technical control

  • Expression validation using RT-PCR or Western blotting

What bioinformatic tools are most appropriate for predicting the function of ywaF?

For comprehensive bioinformatic analysis of ywaF, employ multiple prediction tools in sequence:

  • Primary sequence analysis: BLAST, HMMER, and InterProScan to identify conserved domains and homologs

  • Structural prediction: AlphaFold2, I-TASSER, or Phyre2 for 3D structure modeling

  • Subcellular localization: PSORTb, SignalP, and TMHMM for cellular targeting signals

  • Functional prediction: EFICAz, PRIAM, and COFACTOR for enzyme function prediction

  • Genomic context analysis: Examine neighboring genes, as co-evolution often suggests functional relationships

  • Phylogenetic profiling: Compare presence/absence patterns across bacterial species

When analyzing uncharacterized proteins in B. subtilis, it's important to recognize potential functional signatures such as the Walker A motif, which is found in P-loop-containing proteins like YvcJ and indicates nucleotide-binding capability . The absence or presence of such motifs in ywaF would provide valuable clues to its function.

What expression systems are optimal for recombinant ywaF protein production and what yields can be expected?

Expression SystemAdvantagesDisadvantagesExpected YieldOptimal for ywaF?
E. coli BL21(DE3)High yields, ease of use, well-established protocolsPotential incorrect folding of B. subtilis proteins, inclusion body formation10-100 mg/LGood for initial studies
B. subtilis WB800Native folding environment, secretion capability, reduced proteolysisLower yields than E. coli, more complex media requirements5-50 mg/LExcellent for functional studies
B. subtilis RKC-1 (ΔlytC)Increased biomass (20% higher than wild type), reduced autolysisAltered cell morphology may affect protein folding6-60 mg/LGood for stability studies
C41(DE3) E. coliSpecialized for toxic or membrane proteinsLess established than BL218-80 mg/LConsider if toxicity observed

For optimal expression of ywaF, consider the approach used for successful expression of yvcJ, where the gene was amplified by PCR, cloned into expression vector pET21a(+) with affinity tags (T7 tag at N-terminus and polyhistidine tag at C-terminus), transformed into E. coli strain C41(DE3), and purified using nickel-nitrilotriacetic acid resin . This strategy enabled successful purification of the recombinant YvcJ protein for subsequent characterization.

For B. subtilis expression, recent chassis engineering approaches show promise, with strains like RKC-1 (ΔlytC) demonstrating 20% increased biomass, which could lead to higher protein yields .

What purification challenges are specific to ywaF and how can they be overcome?

As an uncharacterized protein, ywaF presents several purification challenges that require systematic troubleshooting:

  • Solubility issues: If ywaF forms inclusion bodies, optimize by:

    • Reducing expression temperature to 16-20°C

    • Using solubility-enhancing fusion partners (SUMO, TrxA, GST)

    • Co-expressing with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Testing various detergents for membrane-associated proteins

  • Stability considerations:

    • Include protease inhibitors during all purification steps

    • Test thermal stability to determine optimal buffer conditions

    • Consider engineered B. subtilis strains with reduced autolysis properties, such as RKC-1 to RKC-9, which show improvements in biomass and potentially protein yield

  • Purity assessment:

    • SDS-PAGE with Coomassie and silver staining

    • Western blotting if antibodies available

    • Mass spectrometry for final confirmation

  • Tag removal strategies:

    • Use precision proteases (TEV, PreScission)

    • Optimize cleavage conditions to maintain protein solubility

    • Second affinity chromatography to remove cleaved tag

How can researchers validate the functional integrity of purified recombinant ywaF?

Validating functional integrity requires multiple analytical approaches:

  • Biophysical characterization:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to assess stability

    • Dynamic light scattering for aggregation analysis

    • Native PAGE for oligomeric state determination

  • Activity assessment:

    • Design assays based on bioinformatic predictions

    • If homology exists with nucleotide-binding proteins like YvcJ, test ATP/GTP binding and hydrolysis

    • Consider substrate screening if functional class is predicted

  • Structural integrity:

    • Limited proteolysis to confirm proper folding

    • NMR 1D spectra to verify tertiary structure

    • Compare experimental data with bioinformatic predictions

  • Complementation studies:

    • Introduce purified protein to knockout strains in vitro

    • Assess restoration of phenotypes in biochemical assays

What approaches can identify potential interaction partners of ywaF in Bacillus subtilis?

Identifying interaction partners requires both in vivo and in vitro approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express ywaF with affinity tag in B. subtilis

    • Purify under native conditions to maintain interactions

    • Identify co-purifying proteins by mass spectrometry

    • Validate with reciprocal pull-downs and co-immunoprecipitation

  • Bacterial two-hybrid (B2H) screening:

    • Create ywaF fusion with split reporter protein

    • Screen against B. subtilis genomic library

    • Validate positive interactions with complementary techniques

  • Proximity-dependent biotin labeling (BioID):

    • Fuse ywaF to promiscuous biotin ligase

    • Express in B. subtilis and identify biotinylated proteins

    • Cross-reference with AP-MS data for higher confidence

  • Crosslinking studies:

    • Apply in vivo crosslinking to capture transient interactions

    • Identify crosslinked products by mass spectrometry

    • Map interaction interfaces through MS/MS analysis

  • Co-expression network analysis:

    • Integrate transcriptomic data to identify co-expressed genes

    • Look for consistent patterns across multiple conditions

How can RNA-seq and proteomics be integrated to understand the impact of ywaF deletion on global gene expression?

Integrating RNA-seq and proteomics requires careful experimental design and data analysis:

  • Experimental design:

    • Compare wild-type, ΔywaF, and complemented strains

    • Include biological triplicates for statistical robustness

    • Test multiple growth conditions to identify condition-specific effects

    • Include time-course experiments to capture dynamic responses

  • RNA-seq analysis workflow:

    • Extract total RNA with RIN values >8

    • Enrich for mRNA (deplete rRNA)

    • Prepare libraries with unique barcodes

    • Sequence to minimum 20M reads per sample

    • Analyze differential expression using DESeq2 or edgeR

  • Proteomics workflow:

    • Extract proteins from matched samples used for RNA-seq

    • Perform tryptic digestion and label with TMT/iTRAQ

    • Fractionate peptides to increase coverage

    • Analyze by LC-MS/MS

    • Quantify proteins using MaxQuant or PEAKS

  • Integration strategies:

    • Calculate mRNA-protein correlation coefficients

    • Identify discordant genes (changed at mRNA but not protein level or vice versa)

    • Perform pathway enrichment on concordant and discordant sets

    • Create integrated regulatory networks

  • Functional validation:

    • Confirm key findings with targeted experiments

    • Test phenotypic consequences of identified pathways

What are the appropriate controls when performing complementation studies with ywaF?

  • Genetic controls:

    • Wild-type B. subtilis (positive control)

    • ΔywaF strain with empty vector (negative control)

    • ΔywaF strain with vector expressing ywaF (complementation)

    • ΔywaF strain with vector expressing ywaF point mutants (functional domain mapping)

    • ΔywaF strain with vector expressing homologous genes from related species (functional conservation)

  • Expression controls:

    • Confirm expression levels by qRT-PCR and Western blot

    • Use inducible promoters to test dose-dependent effects

    • Include tagged versions for protein localization

  • Phenotypic analysis:

    • Assess growth in various media and stress conditions

    • Measure specific metabolic activities relevant to predicted function

    • Examine cellular morphology by microscopy

    • Assess changes in relevant biochemical pathways

For optimal experimental design, consider the approach used for yvcJ complementation, where PCR fragments containing the promoter region with either the yvcI gene or the yvcIJ genes were amplified, digested, and ligated into pAC7 for transformation into the knockout strain .

What growth conditions should be tested to identify phenotypes in ywaF knockout strains?

Comprehensive phenotypic profiling requires testing diverse conditions:

Growth ConditionRationaleParameters to MeasureExpected Insights
Rich media (LB)Baseline growthGrowth rate, maximum ODGeneral fitness effects
Minimal mediaMetabolic capabilitiesGrowth rate, auxotrophiesInvolvement in biosynthetic pathways
Carbon source variationMetabolic flexibilityGrowth on different carbon sourcesRole in carbon metabolism
Temperature stress (16-50°C)Stress responseGrowth, survival ratesInvolvement in temperature adaptation
Osmotic stressCell envelope integrityGrowth with varying NaCl/sucroseRole in osmotic regulation
Oxidative stress (H₂O₂)Redox functionsSurvival, ROS productionInvolvement in oxidative stress response
Nutrient limitationStarvation responseSurvival during extended stationary phaseRole in nutrient sensing
Sporulation conditionsDevelopmental pathwaysSporulation efficiency, germinationRole in B. subtilis differentiation
Biofilm formationMulticellular behaviorBiofilm architecture, matrix productionRole in community behaviors

When analyzing phenotypes, consider morphological examination similar to what was performed for various B. subtilis knockout strains, which revealed significant changes in cell length (e.g., ΔlytC strain showing 4.5 times longer cells) and other morphological features that provided insights into gene function .

How can researchers differentiate between direct and indirect effects of ywaF deletion?

Differentiating between direct and indirect effects requires systematic experimental approaches:

  • Temporal analysis:

    • Monitor transcriptomic and proteomic changes at multiple time points after gene deletion

    • Early changes are more likely to represent direct effects

    • Construct temporal networks to identify causality

  • Dose-dependent complementation:

    • Use inducible promoters to express ywaF at various levels

    • Correlate expression levels with phenotype restoration

    • Direct effects typically show stronger dose-dependency

  • Epistasis analysis:

    • Create double knockouts with genes in suspected pathways

    • Analyze whether phenotypes are additive, suppressive, or synergistic

    • Map functional relationships and pathway positions

  • Biochemical validation:

    • Test direct biochemical activities using purified ywaF

    • Confirm substrate specificity and enzymatic parameters

    • Reconstitute minimal systems in vitro

  • Suppressor screening:

    • Select for suppressor mutations that rescue ΔywaF phenotypes

    • Identify pathways that can compensate for ywaF function

    • Map genetic interactions through whole-genome sequencing

What protein localization methods are most effective for determining the subcellular distribution of ywaF in B. subtilis?

Effective protein localization requires complementary approaches:

  • Fluorescent protein fusions:

    • Create N- and C-terminal GFP/mCherry fusions

    • Express from native locus and validate functionality

    • Image live cells at different growth phases

    • Use time-lapse microscopy to track dynamic localization

  • Immunofluorescence microscopy:

    • Generate specific antibodies against ywaF

    • Optimize fixation conditions for B. subtilis

    • Perform co-localization with known subcellular markers

    • Use super-resolution techniques (STED, PALM) for detailed localization

  • Biochemical fractionation:

    • Separate membrane, cytoplasmic, and nucleoid fractions

    • Detect ywaF by Western blotting

    • Compare distribution under different growth conditions

    • Analyze post-translational modifications in different fractions

  • Electron microscopy:

    • Perform immunogold labeling for EM localization

    • Analyze distribution at ultrastructural level

    • Combine with cryo-electron tomography for 3D context

  • Proximity-based methods:

    • Use APEX2 fusion for spatially-restricted biotinylation

    • Identify neighboring proteins through mass spectrometry

    • Create spatial interaction maps

For morphological analysis, consider approaches used to examine B. subtilis strains through scanning electron microscopy, transmission electron microscopy, and field emission scanning electron microscopy, which successfully revealed significant morphological changes in various knockout strains .

How should researchers analyze high-throughput data to generate hypotheses about ywaF function?

Analysis of high-throughput data requires systematic bioinformatic workflows:

  • Differential expression analysis:

    • Use appropriate statistical methods (DESeq2, limma, etc.)

    • Apply multiple testing correction (Benjamini-Hochberg)

    • Set significance thresholds (adjusted p-value <0.05, log2FC >1)

    • Visualize with volcano plots and heatmaps

  • Functional enrichment:

    • Perform GO term, KEGG pathway, and protein domain enrichment

    • Use specialized databases for B. subtilis (SubtiWiki, BsubCyc)

    • Apply both hypergeometric tests and gene set enrichment analysis

    • Validate enrichment with permutation testing

  • Network analysis:

    • Construct protein-protein interaction networks

    • Identify differentially regulated modules

    • Perform topological analysis to find key nodes

    • Compare network changes across conditions

  • Integrative analysis:

    • Correlate transcriptomic, proteomic, and metabolomic data

    • Apply multi-omics data integration (MOFA, DIABLO)

    • Identify concordant and discordant patterns

    • Develop predictive models of ywaF function

  • Comparative genomics:

    • Analyze ywaF conservation across bacterial species

    • Correlate presence/absence with metabolic capabilities

    • Examine synteny and operon structure

    • Identify co-evolving genes

What statistical approaches are appropriate for analyzing growth phenotypes in ywaF mutants?

Robust statistical analysis of growth phenotypes requires:

  • Growth curve analysis:

    • Measure OD600 at regular intervals (e.g., Bioscreen C)

    • Calculate growth parameters (lag phase, doubling time, maximum OD)

    • Apply parametric models (Gompertz, logistic, Richards)

    • Compare parameters using ANOVA with post-hoc tests

  • Fitness calculations:

    • Compute relative fitness (W = ln(Nf/Ni)mutant/ln(Nf/Ni)WT)

    • Use competitive growth assays for sensitive detection

    • Apply linear mixed models to account for batch effects

    • Calculate selection coefficients for evolutionary context

  • Multivariate analysis:

    • Principal component analysis for condition clustering

    • Hierarchical clustering of strains based on growth profiles

    • Random forest to identify predictive conditions

    • Support vector machines for phenotype classification

  • Time-series analysis:

    • Apply functional data analysis to full growth curves

    • Use dynamic time warping for curve comparison

    • Identify significant differences in curve shapes

    • Model growth dynamics with differential equations

  • Reproducibility assessment:

    • Calculate coefficients of variation across replicates

    • Perform power analysis to determine sample size

    • Use bootstrapping for robust confidence intervals

    • Apply Bayesian approaches for improved uncertainty quantification

How can computational modeling inform hypotheses about ywaF function in B. subtilis metabolism?

Computational modeling provides valuable context for experimental data:

  • Metabolic network analysis:

    • Integrate ywaF into genome-scale metabolic models of B. subtilis

    • Perform flux balance analysis with and without ywaF

    • Predict growth phenotypes on different substrates

    • Identify potential metabolic roles through gap-filling algorithms

  • Protein structure prediction and analysis:

    • Generate structural models using AlphaFold2 or Rosetta

    • Perform molecular docking with potential substrates

    • Analyze conservation of surface residues

    • Identify potential catalytic sites through structural alignment

  • Systems-level modeling:

    • Develop ordinary differential equation models of relevant pathways

    • Simulate perturbations with and without ywaF

    • Apply parameter sensitivity analysis to identify key interactions

    • Test alternative hypothesis through model comparison

  • Machine learning approaches:

    • Train classifiers on known protein functions

    • Apply to ywaF to predict functional categories

    • Use explainable AI to identify key sequence features

    • Implement active learning to guide experimental design

  • Integration with experimental validation:

    • Design experiments to test computational predictions

    • Refine models based on experimental results

    • Develop iterative cycles of prediction and validation

    • Quantify uncertainty in functional assignments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.