Recombinant Bacillus subtilis Uncharacterized protein ywbG (ywbG)

Shipped with Ice Packs
In Stock

Description

Overview of Uncharacterized Proteins in Bacillus subtilis

Uncharacterized proteins like YwbG represent hypothetical or poorly studied gene products in B. subtilis. These proteins are often annotated based on genomic sequencing but lack experimental validation of their structure, function, or biological role.

Key Features of YwbG (Hypothetical Analysis):

  • Gene Locus: ywbG (GenBank: AL009126.3, UniProt: P54552).

  • Sequence Properties: Predicted molecular weight, isoelectric point (pI), and domain architecture can be inferred via bioinformatics tools like InterPro or Pfam.

  • Conservation: Homologs may exist in related Bacillus species, suggesting evolutionary conservation.

Recombinant Expression of Uncharacterized Proteins in B. subtilis

While no direct studies on YwbG were found, B. subtilis is widely used for recombinant protein production due to:

  • Secretion Efficiency: Utilizes Sec or Tat pathways for extracellular protein export .

  • Strain Optimization: Genome-reduced strains (e.g., IIG-Bs27-31) improve yields by minimizing proteolytic degradation .

  • Vector Systems: Common plasmids like pHT43 enable inducible or constitutive expression .

Typical Workflow for Characterizing YwbG:

  1. Gene Cloning: Amplify ywbG from B. subtilis genomic DNA and clone into an expression vector (e.g., pET-28a with His-tag).

  2. Expression Testing: Use IPTG or autoinduction systems in B. subtilis strains (e.g., WB800N) .

  3. Protein Purification: Affinity chromatography (Ni-NTA for His-tagged proteins) followed by SDS-PAGE and Western blot validation.

Challenges in Studying Uncharacterized Proteins

  • Functional Annotation: Requires structural studies (X-ray crystallography, NMR) or knockout assays to infer biological roles.

  • Stability Issues: Protease-deficient strains (e.g., WB800N) are often essential to prevent degradation .

  • Secretion Compatibility: Signal peptides (e.g., LipA, AmyE) must be tested for efficient YwbG export .

Future Research Directions

To characterize YwbG, researchers might:

  • Perform transcriptomic/proteomic profiling under stress conditions.

  • Conduct protein-protein interaction screens (e.g., yeast two-hybrid).

  • Engineer fusion proteins (e.g., GFP-tagged YwbG) for localization studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting into smaller portions at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a guideline for your own storage protocols.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
In general, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form, on the other hand, boasts a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is essential for multiple uses. To ensure optimal preservation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your preferred tag.
Synonyms
ywbG; BSU38330; ipa-22r; Uncharacterized protein YwbG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywbG
Target Protein Sequence
MFIGIVSLFLTVLVYLGAKKVYQRFPRVYTSPLLVTPAVLVGLLLLVNVPYESYNLGGGL LTDMLQPATVAFAIPLYKYFPVLKKYAVEIILNVAVGSCIAIISTALIAKWLHLGTGLID SLVPRSVTTPIAMNVSEMIGGMPAVTAVFVILTALLGTVIGPMVIRYFRIDNEIARGVLL GTSAHGAGTSKAFELSSVSGTISSVSMILAAIMTLCAAPFLLSFM
Uniprot No.

Target Background

Database Links
Protein Families
YohK (E.coli)/YwbG (IPA-22R) (B.subtilis) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the uncharacterized protein ywbG in Bacillus subtilis?

The ywbG protein in Bacillus subtilis is classified as an uncharacterized protein, indicating limited knowledge about its specific function. B. subtilis is a gram-positive bacteria naturally found in the human gut and in fermented foods . Like many uncharacterized proteins, ywbG has been identified through genomic sequencing but lacks comprehensive functional and structural characterization. Current research approaches involve employing bioinformatic tools for predicting its physicochemical parameters, domain and motif searches, and cellular localization to gain insights into its potential functions .

What are the best methods for expressing recombinant ywbG protein in B. subtilis?

For efficient expression of recombinant ywbG protein in B. subtilis, a recommended approach is to use an inducible promoter system similar to the maltose-inducible P* promoter that has been successfully employed for other B. subtilis proteins . The expression can be optimized by inserting the promoter upstream of the target gene via a single crossover event. This method allows for controlled expression and can potentially increase protein yield by 2-4 times when properly induced, as demonstrated with other recombinant proteins in B. subtilis . The copy number of the integrant can be amplified through high-concentration resistance screening to achieve 4-5 copies, which further enhances protein production.

What expression vectors are most suitable for ywbG protein production?

Based on successful recombinant protein expression in B. subtilis, vectors containing maltose-inducible promoters have shown significant efficacy. These systems allow for controlled expression and can be integrated into the genome, providing stable expression . For ywbG specifically, vectors that allow for the addition of purification tags (such as His-tag or FLAG-tag) would facilitate downstream purification and analysis. The integration of the expression cassette into the B. subtilis genome, rather than using plasmid-based systems, often provides more stable expression and consistent protein yields for structural and functional studies.

What bioinformatic approaches should be used to predict the function of ywbG?

For predicting the function of uncharacterized proteins like ywbG, a comprehensive bioinformatic approach should be employed. This includes analysis of physicochemical parameters, domain identification, motif searches, pattern recognition, and localization prediction . Specifically, tools such as InterProScan, Motif, SMART, HMMER, NCBI CDART, and BlastP search are effective for identifying functional domains. For increased accuracy, assign probable functions only when conserved domains are predicted by two or more databases - this approach has demonstrated approximately 83.6% accuracy in function prediction for previously uncharacterized proteins .

How can I experimentally validate the predicted function of ywbG?

Experimental validation of predicted functions for ywbG should follow a systematic approach. First, generate a recombinant strain with the ywbG gene knockout to observe phenotypic changes. Second, complement with the wild-type gene to confirm the phenotype is specifically related to ywbG. Third, express and purify the recombinant protein to test biochemical activities predicted by bioinformatic analysis. Fourth, conduct protein-protein interaction studies using techniques like bacterial two-hybrid systems or co-immunoprecipitation to identify interacting partners . Finally, perform in vitro assays specific to the predicted function (enzymatic, binding, or structural) to confirm activity directly.

What protein-protein interaction studies are most effective for understanding ywbG's role?

For understanding protein-protein interactions of ywbG, string analysis has proven particularly effective for uncharacterized proteins . This approach reveals potential interacting partners and places the protein within functional networks. Complementary experimental approaches include bacterial two-hybrid systems specifically optimized for B. subtilis, pull-down assays using tagged recombinant ywbG, and crosslinking studies followed by mass spectrometry identification of binding partners. When combined with functional assays, these methods can provide significant insights into the biological role of ywbG within the cellular context of B. subtilis.

What methods are recommended for determining the structure of ywbG protein?

For structural determination of ywbG, a multi-tiered approach is recommended. Begin with homology-based structure prediction using Swiss PDB and Phyre2 servers, which have successfully modeled uncharacterized proteins with reasonable accuracy . For experimental structure determination, X-ray crystallography remains the gold standard if the protein can be crystallized. Express ywbG with appropriate tags for purification, optimize buffer conditions through thermal shift assays, and screen various crystallization conditions. If crystallization proves challenging, nuclear magnetic resonance (NMR) spectroscopy can be employed for smaller domains. Cryo-electron microscopy (cryo-EM) is increasingly valuable for proteins that resist crystallization, especially if ywbG forms complexes with other proteins.

How can I predict tertiary structure elements of ywbG without experimental data?

In the absence of experimental structural data, tertiary structure elements of ywbG can be predicted using advanced computational methods. Start with servers like Phyre2, Swiss-Model, and AlphaFold, which have demonstrated success in modeling uncharacterized proteins . Compare outputs from multiple prediction tools to identify consistent structural elements. Molecular dynamics simulations can further refine these models and provide insights into flexibility and potential binding sites. Secondary structure predictions (using tools like PSIPRED) can validate the tertiary model elements. Additionally, evolutionary coupling analysis can identify amino acid pairs that are likely in close proximity in the folded structure, providing constraints for model refinement.

How can I design a CRISPR-Cas9 system for modifying the ywbG gene in B. subtilis?

Designing a CRISPR-Cas9 system for ywbG modification requires several specific considerations for B. subtilis. First, select a codon-optimized Cas9 variant demonstrated to function efficiently in B. subtilis. Second, design sgRNAs targeting the ywbG gene with minimal off-target effects using tools specifically validated for B. subtilis genome editing. Include appropriate homology arms (500-1000 bp) flanking your modification for efficient homology-directed repair. For delivery, utilize integration vectors that can stably maintain the CRISPR components in B. subtilis. Monitor transformation efficiency carefully, as CRISPR-mediated editing can be toxic to B. subtilis. Screen transformants using colony PCR and sequence verification to confirm successful editing of the ywbG locus without introducing unintended modifications elsewhere in the genome.

What high-throughput methods can identify potential substrates or binding partners of ywbG?

For identifying substrates or binding partners of ywbG, several high-throughput methods are particularly effective. Protein microarrays containing the B. subtilis proteome can be probed with purified labeled ywbG to identify direct interactions. Affinity purification coupled with mass spectrometry (AP-MS) using tagged ywbG as bait can capture protein complexes in their native cellular environment. Bacterial two-hybrid library screens using the B. subtilis genomic library can identify genetic interactions. Metabolomic profiling comparing wild-type and ywbG knockout strains can reveal metabolic pathways affected by ywbG function. Cross-linking mass spectrometry (XL-MS) can capture transient interactions within the cellular milieu. Integration of data from these complementary approaches provides the most comprehensive understanding of ywbG's interaction network.

How conserved is ywbG across different Bacillus species and what does this suggest about its function?

The conservation pattern of ywbG across Bacillus species can provide significant insights into its functional importance. Perform comprehensive phylogenetic analysis using both blastp and tblastn searches against available Bacillus genomes to identify homologs. Calculate sequence identity and similarity percentages across species, and construct phylogenetic trees to visualize evolutionary relationships. Highly conserved regions likely indicate functional domains critical for protein activity. If ywbG is highly conserved across all Bacillus species, it likely performs an essential function. Conversely, if it shows variable conservation or appears only in certain subgroups, it may have specialized functions related to specific ecological niches or metabolic capabilities. Correlate conservation patterns with known physiological or metabolic differences between species to further narrow potential functions.

What can synteny analysis tell us about the function of ywbG in the context of B. subtilis?

Synteny analysis—examining the genomic context surrounding ywbG—can provide valuable clues about its function. First, identify genes adjacent to ywbG in B. subtilis and determine if they form part of an operon structure, suggesting functional relationships. Compare this genomic arrangement across multiple Bacillus species to identify consistently co-located genes, which often participate in the same biological pathways. Analyze the functions of conserved neighboring genes, as this can suggest involvement of ywbG in specific cellular processes. For instance, proximity to genes involved in biotin biosynthesis might suggest a role in this pathway, similar to other characterized B. subtilis proteins . Pay particular attention to regulatory elements in the genomic neighborhood, as these can indicate conditions under which ywbG is expressed, further narrowing its potential functional roles.

Could ywbG play a role in biotin biosynthesis pathways in B. subtilis?

Given B. subtilis' established role in biotin biosynthesis, investigating ywbG's potential involvement in this pathway is warranted. Biotin biosynthesis in B. subtilis involves precursors like pimelic acid , and uncharacterized proteins often play roles in such essential metabolic pathways. To investigate this possibility, perform growth assays comparing wild-type and ywbG-knockout strains in biotin-limited media. Conduct metabolic profiling focusing on biotin pathway intermediates to identify any accumulation or depletion patterns. Perform complementation studies with known biotin pathway genes to identify functional relationships. Analyze protein-protein interactions between ywbG and known biotin biosynthesis enzymes. Additionally, examine gene expression patterns of ywbG under biotin limitation conditions. This systematic approach can determine whether ywbG functions directly in biotin biosynthesis or in related metabolic processes.

What is the potential role of ywbG in B. subtilis stress response mechanisms?

To investigate ywbG's potential role in stress response, first examine its expression patterns under various stress conditions (heat shock, osmotic stress, nutrient limitation, oxidative stress) using qRT-PCR or RNA-seq analyses. Compare the phenotype of ywbG knockout strains with wild-type B. subtilis under these stress conditions, looking for differences in growth rate, survival, and morphology. Perform complementation studies to confirm phenotypic differences are specifically attributable to ywbG. Analyze the ywbG promoter region for stress-responsive elements that might indicate regulation by known stress response transcription factors. Conduct metabolomic and proteomic analyses of wild-type versus knockout strains under stress conditions to identify affected pathways. If ywbG exhibits stress-responsive expression or its deletion affects stress survival, this would strongly suggest a role in stress adaptation mechanisms, which are crucial for B. subtilis survival in diverse environments .

What are the common challenges in purifying recombinant ywbG protein and how can they be addressed?

Purification of uncharacterized proteins like ywbG often presents specific challenges that can be systematically addressed. Insolubility is a common issue—if ywbG forms inclusion bodies, optimize by lowering expression temperature (16-20°C), reducing inducer concentration, or using solubility-enhancing fusion tags like SUMO or MBP. For degradation problems, include protease inhibitors throughout purification and consider engineering out potential protease recognition sites. If protein yield is low, optimize codon usage for B. subtilis expression systems and test different promoter strengths. For aggregation issues, screen various buffer conditions using dynamic light scattering to identify stabilizing formulations. If ywbG co-purifies with contaminating proteins, implement additional purification steps such as ion exchange or size exclusion chromatography. Each of these optimizations should be systematically tested and documented to develop a reproducible purification protocol.

How can I troubleshoot inconsistent results in functional assays involving ywbG?

Inconsistent functional assay results for uncharacterized proteins like ywbG typically stem from several factors that can be systematically addressed. First, verify protein quality through SDS-PAGE, Western blotting, and mass spectrometry to confirm identity, purity, and integrity. Implement strict quality control metrics before proceeding with functional assays. Second, ensure protein is properly folded using circular dichroism spectroscopy or thermal shift assays. Third, standardize all buffers, reagents, and experimental conditions—minor variations in pH, salt concentration, or temperature can significantly impact activity of uncharacterized proteins. Fourth, include positive and negative controls in each assay to normalize results. Fifth, validate that the assay itself is appropriate for detecting the predicted activity—bioinformatic predictions may suggest general function categories requiring different detection methods . Finally, consider that ywbG may require cofactors, binding partners, or post-translational modifications to exhibit full activity, and design experiments to systematically test these requirements.

What bioinformatic pipelines are most effective for analyzing ywbG sequence and structural data?

For comprehensive analysis of ywbG, implement a multi-faceted bioinformatic pipeline that integrates various analytical approaches. Begin with sequence analysis using BLAST, HMMER, and profile-based methods to identify distant homologs that might provide functional insights. Apply InterProScan and other domain prediction tools, but focus on domains predicted by multiple tools to achieve accuracy rates of approximately 83.6% . For structural analysis, employ multiple prediction servers (Phyre2, Swiss-Model, AlphaFold) and compare their outputs to identify consistent structural features. Implement molecular dynamics simulations to predict flexible regions and potential binding sites. For evolutionary analysis, use tools like ConSurf to identify conserved surface patches that might indicate functional sites. Compile an integrated prediction that combines these various streams of evidence, weighing each according to statistical confidence levels. This comprehensive approach has proven effective for annotating previously uncharacterized proteins and can be applied successfully to ywbG characterization.

How can I distinguish between direct and indirect effects when analyzing phenotypes of ywbG knockout strains?

Distinguishing direct from indirect effects in ywbG knockout phenotypes requires a systematic approach. First, perform comprehensive complementation studies using the wild-type ywbG gene to confirm phenotypes are directly attributable to ywbG loss. Second, create point mutations in predicted functional domains of ywbG to correlate specific protein features with observed phenotypes. Third, conduct time-course experiments to identify primary (early) versus secondary (late) effects of ywbG deletion. Fourth, implement systems biology approaches including transcriptomics, proteomics, and metabolomics to map the cascade of changes following ywbG knockout. Analyze this data to distinguish immediate molecular consequences from downstream effects. Fifth, perform epistasis analysis by creating double knockouts with genes in suspected related pathways. Finally, direct biochemical validation of predicted ywbG functions in vitro can definitively link the protein to specific cellular processes, helping differentiate its direct molecular functions from broader physiological effects observed in knockout strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.