Recombinant Bacillus subtilis Uncharacterized protein ywcB (ywcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Protein ywcB (ywcB)

Recombinant Bacillus subtilis uncharacterized protein ywcB (ywcB) is a bioengineered protein expressed in heterologous systems, primarily E. coli or yeast, for research purposes. Despite its classification as "uncharacterized," structural and production data indicate its utility in molecular biology studies, particularly for investigating protein interactions or serving as a control in biochemical assays. The protein is derived from the ywcB gene (Uniprot ID: P39600), located in the B. subtilis genome (locus: BSU38230), and shares sequence homology with transmembrane transporters or membrane-associated proteins .

Sequence and Domain Features

The full-length ywcB protein consists of 102 amino acids (MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSWAWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT) . Key structural attributes include:

  • Transmembrane Potential: Predicted hydrophobic regions suggest membrane association .

  • Tag Information: Recombinant versions typically include an N-terminal 10xHis-tag for purification via metal affinity chromatography .

PropertyValueSource
Molecular WeightNot explicitly reported (estimated from sequence length)
Expression SystemE. coli or yeast
Purity>80% by SDS-PAGE
Endotoxin Level<1.0 EU/μg (LAL method)
Storage BufferTris-based buffer with 50% glycerol or PBS

Host Systems and Optimization

ywcB is produced via recombinant DNA technology, with E. coli being the primary host . Key steps include:

  1. Cloning: Insertion of the ywcB gene into expression vectors (e.g., pET16, pNDH33) under inducible promoters .

  2. Induction: IPTG-driven expression in E. coli cultures, followed by cell lysis and purification .

  3. Yield Challenges: Limited data suggest moderate yields, typical for membrane-associated proteins .

Genomic Context

In B. subtilis strain PY79, the ywcB locus is part of a hybrid genomic region near sacA and ywcI, exhibiting W23-like sequences in certain strains . This suggests potential functional divergence between B. subtilis lineages.

Current Research Gaps

No published studies directly investigate ywcB’s biochemical function. Its "uncharacterized" status reflects the need for:

  • Functional Screens: Enzyme assays or interaction studies to identify catalytic activity or binding partners.

  • Localization Studies: Fluorescence microscopy or fractionation to confirm membrane association.

Potential Applications

While speculative, ywcB’s recombinant forms may serve as:

  • Control Proteins: In membrane protein folding or secretion pathway studies .

  • Bait in Interaction Studies: To identify novel binding partners in B. subtilis or heterologous systems .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
ywcB; BSU38230; ipa-32r; Uncharacterized protein YwcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywcB
Target Protein Sequence
MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSW AWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the function of uncharacterized protein ywcB in Bacillus subtilis?

The ywcB protein in B. subtilis remains largely uncharacterized, similar to other proteins like YhgB and YhbB that have been identified in the B. subtilis genome but lack functional annotation. While specific functions have not been definitively established, researchers can employ comparative genomics and structural prediction tools to generate hypotheses about potential functions. Approaches might include sequence comparison with characterized proteins such as YvcI, which has been identified as an RNA pyrophosphohydrolase involved in RNA degradation regulation . Bioinformatic analyses of conserved domains and structural motifs can provide initial insights into possible enzymatic activities or cellular roles.

What expression systems are most effective for producing recombinant B. subtilis ywcB protein?

The optimal expression system depends on research objectives and downstream applications. E. coli systems typically offer high yields and straightforward protocols for initial characterization work . For proteins requiring post-translational modifications or when facing solubility challenges, yeast, baculovirus, or mammalian cell expression systems may be preferable, though at higher cost and complexity . When selecting an expression system, consider:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growth, high yieldsLimited post-translational modifications10-100 mg/L
YeastBetter folding, some post-translational modificationsLonger production time5-50 mg/L
BaculovirusComplex eukaryotic modifications, good for toxic proteinsTechnical complexity, higher cost1-50 mg/L
Mammalian cellsFull post-translational modificationsHighest cost, lowest yields0.1-10 mg/L

For initial characterization of ywcB, an E. coli system with solubility-enhancing fusion tags is recommended, with optimization of induction conditions to balance yield and solubility.

How can I optimize solubility when expressing recombinant B. subtilis ywcB protein?

Uncharacterized proteins often present solubility challenges. To optimize solubility when expressing ywcB:

  • Employ solubility-enhancing fusion tags (SUMO, MBP, GST, or TRX)

  • Test multiple expression temperatures (16°C, 25°C, 30°C, 37°C), with lower temperatures generally favoring proper folding

  • Optimize inducer concentration and induction timing

  • Investigate vesicle-based expression systems which have been shown to facilitate production of challenging proteins by compartmentalizing them within microenvironments

  • Consider codon optimization for the expression host

  • Add solubility enhancers to lysis buffers (glycerol, mild detergents, or specific salt concentrations)

If persistent insolubility occurs, structural characterization may still be possible through refolding protocols or specialized solubilization methods.

What purification strategy is most effective for obtaining high-purity ywcB protein?

A multi-step purification strategy is typically necessary to achieve research-grade purity. For His-tagged recombinant ywcB:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins

  • Intermediate purification: Ion exchange chromatography based on predicted isoelectric point

  • Polishing: Size exclusion chromatography

Buffer optimization is critical at each step. For uncharacterized proteins like ywcB, perform stability screening across different pH ranges (typically pH 6.0-8.0) and salt concentrations (0-500 mM NaCl). Incorporate 5-10% glycerol to enhance stability and prevent aggregation. If the protein contains structural motifs similar to the Nudix hydrolase domain found in YvcI , consider including divalent cations like Mn²⁺ in purification buffers, as these may be required for structural integrity.

What approaches can I use to determine the structure of ywcB when no structural information is available?

Structural characterization of uncharacterized proteins requires a multi-technique approach:

  • Bioinformatic prediction:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Homology modeling if sequence similarity exists with characterized proteins

  • Experimental techniques:

    • Circular dichroism (CD) spectroscopy for secondary structure composition

    • Limited proteolysis coupled with mass spectrometry to identify domains

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

    • X-ray crystallography or cryo-EM for high-resolution structures

  • NMR spectroscopy:

    • Especially valuable for identifying dynamic regions and ligand-binding sites

    • Requires ¹⁵N/¹³C-labeled protein samples

Start with computational predictions and CD spectroscopy to guide more resource-intensive techniques like crystallography. For proteins like ywcB with no available structures, obtaining diffraction-quality crystals may require extensive screening of crystallization conditions.

What high-throughput approaches can be used to identify potential functions of uncharacterized B. subtilis proteins like ywcB?

Several parallel approaches can accelerate functional discovery:

  • Phenotypic screening:

    • Gene knockout/knockdown followed by growth under various stressors

    • Overexpression phenotyping in both B. subtilis and heterologous hosts

    • Sporulation efficiency analysis if the protein may function similarly to spoVIF (yjcC)

  • Protein-protein interaction screens:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling (BioID or APEX2 fusion proteins)

  • Metabolomics and transcriptomics:

    • Compare metabolite profiles between wild-type and ywcB mutants

    • RNA-seq to identify genes differentially expressed in response to ywcB manipulation

  • Enzymatic activity screens:

    • Test for hydrolase activity using substrate panels if sequence analysis suggests similarity to Nudix hydrolases like YvcI

    • Screen for RNA binding capability if the protein contains nucleic acid binding motifs

Track all experimental conditions carefully, as uncharacterized proteins may have context-dependent functions that only manifest under specific conditions (e.g., pH, ionic strength, presence of cofactors).

How can I determine if ywcB has RNA pyrophosphohydrolase activity similar to other B. subtilis proteins?

Based on the characterization of YvcI as having RNA pyrophosphohydrolase activity , you can develop an experimental workflow to test if ywcB has similar functionality:

  • Sequence and structural motif analysis:

    • Search for Nudix hydrolase motif (GX₅EX₇REUXEEXGU, where U represents hydrophobic residues)

    • Identify possible catalytic glutamate residues

  • In vitro enzymatic assays:

    • Synthesize 5'-triphosphate RNA substrates with different initiating nucleotides

    • Incubate with purified ywcB protein

    • Analyze reaction products using thin-layer chromatography, HPLC, or mass spectrometry

    • Test activity at different pH values (6.0-8.0) and in the presence of various divalent cations (Mg²⁺, Mn²⁺)

  • Mutation analysis:

    • Create point mutations of potential catalytic residues

    • Compare activity of wild-type and mutant proteins

  • Substrate preference determination:

    • Test RNA substrates with different 5' nucleotides (A, G, C, U)

    • Examine the impact of secondary structure near the 5' end

YvcI showed preference for G-initiating RNAs and required at least one unpaired nucleotide at the substrate's 5'-end , which provides a starting point for comparative analysis with ywcB.

How can I design experiments to determine if ywcB plays a role in B. subtilis stress response mechanisms?

Considering B. subtilis' adaptation mechanisms to various stressors, including osmotic challenges , a systematic approach to investigate ywcB's potential role includes:

  • Stress exposure experiments:

    • Generate ywcB deletion and overexpression strains

    • Expose cultures to various stressors (osmotic shock, nutrient limitation, oxidative stress)

    • Monitor growth kinetics, survival rates, and morphological changes

    • Pay particular attention to hypotonic challenges, given B. subtilis' known responses to osmotic shifts

  • Transcriptional regulation analysis:

    • Map the promoter region and identify potential regulatory elements

    • Use reporter gene fusions to determine expression patterns under different conditions

    • Analyze whether ywcB is regulated by stress-responsive sigma factors (σᴮ) similar to ykuT

  • Localization studies:

    • Create fluorescent protein fusions to determine subcellular localization

    • Examine whether localization changes during stress response or sporulation

    • Consider membrane association, particularly if ywcB might function as or interact with mechanosensitive channels

  • Proteomic approaches:

    • Compare protein expression profiles between wild-type and ywcB mutants under stress conditions

    • Identify interaction partners that co-purify with ywcB using pull-down assays

These approaches can reveal whether ywcB functions similarly to characterized stress-response proteins in B. subtilis, such as those involved in osmotic regulation or sporulation.

What techniques can be used to investigate if ywcB is involved in B. subtilis sporulation processes?

Given that some uncharacterized B. subtilis proteins have been found to play roles in sporulation, such as the spoVIF (yjcC) gene involved in spore coat assembly , several experimental approaches can determine if ywcB has similar functions:

  • Sporulation efficiency analysis:

    • Monitor sporulation kinetics in wild-type versus ywcB mutant strains

    • Quantify heat-resistant spore formation

    • Assess lysozyme resistance, which can indicate spore coat integrity issues

  • Transmission electron microscopy:

    • Examine spore ultrastructure in ywcB mutants

    • Look for specific defects in coat assembly, cortex formation, or mother cell lysis

  • Transcriptional analysis:

    • Determine if ywcB expression is temporally regulated during sporulation

    • Identify which sporulation-specific sigma factor might control ywcB expression

    • Analyze dependency on sporulation master regulators (Spo0A, SigE, SigK, GerE)

  • Protein localization during sporulation:

    • Use fluorescence microscopy with fusion proteins to track ywcB localization

    • Compare with known sporulation protein localization patterns

    • Look for forespore or mother cell-specific localization

If ywcB shows similarities to spoVIF, it might be involved in stage VI of sporulation and contribute to spore coat protein assembly that confers lysozyme resistance .

How can I determine if ywcB interacts with mechanosensitive channels in B. subtilis?

Based on the identification of mechanosensitive channels in B. subtilis that play crucial roles in osmotic adaptation , potential interaction with uncharacterized proteins like ywcB can be investigated through:

  • Co-immunoprecipitation studies:

    • Use tagged versions of both ywcB and known channel proteins (MscL, YhdY, YfkC, YkuT)

    • Perform reciprocal pull-downs under various osmotic conditions

    • Validate interactions with alternative methods such as bacterial two-hybrid assays

  • Electrophysiology:

    • Reconstitute purified ywcB with mechanosensitive channels in liposomes

    • Measure channel activity using patch-clamp techniques

    • Determine if ywcB modulates channel conductance, gating properties, or activation thresholds

  • Functional complementation:

    • Test if ywcB expression can restore osmotic shock survival in mechanosensitive channel mutants

    • Create double/triple mutants with ywcB and channel genes to assess genetic interactions

  • Localization studies:

    • Perform co-localization analysis of fluorescently labeled ywcB and channel proteins

    • Examine if co-localization changes during osmotic challenges

This systematic approach can reveal whether ywcB functions as an accessory protein for mechanosensitive channels or plays an independent role in osmotic adaptation.

What methods are most effective for studying potential post-translational modifications of ywcB?

Uncharacterized proteins may undergo post-translational modifications (PTMs) that are critical for their function. To investigate PTMs in ywcB:

  • Mass spectrometry-based approaches:

    • Perform bottom-up proteomics with enrichment strategies for specific modifications

    • Use top-down proteomics to analyze intact proteins and identify modification patterns

    • Compare PTM profiles between different growth conditions and stress responses

  • Site-directed mutagenesis:

    • Identify potential modification sites through bioinformatic prediction

    • Create point mutations at these sites and assess functional consequences

    • Develop phospho-specific or other modification-specific antibodies if key sites are identified

  • In vitro modification assays:

    • Incubate purified ywcB with B. subtilis lysates under different conditions

    • Test specific enzymes that might catalyze modifications (kinases, phosphatases, etc.)

    • Use specific inhibitors to validate enzymatic activities

  • Differential analysis:

    • Compare PTM patterns between recombinant ywcB expressed in E. coli versus native protein from B. subtilis

    • Identify B. subtilis-specific modifications that might be absent in heterologous expression systems

These approaches can reveal regulatory mechanisms controlling ywcB function and provide insights into its integration within cellular signaling networks.

How can I perform comprehensive phylogenetic analysis of ywcB homologs across bacterial species?

Evolutionary analysis can provide significant insights into protein function. For ywcB:

  • Homolog identification:

    • Use iterative sequence search tools (PSI-BLAST, HMMER) to identify distant homologs

    • Search specialized bacterial genome databases

    • Include structurally similar proteins even with low sequence identity

  • Multiple sequence alignment:

    • Align sequences using algorithms optimized for divergent sequences (MAFFT, T-Coffee)

    • Manually refine alignments focusing on conserved motifs and functional residues

    • Identify sequence signatures that might indicate functional specialization

  • Phylogenetic tree construction:

    • Use maximum likelihood or Bayesian inference methods

    • Perform bootstrap analysis to assess node reliability

    • Consider gene neighborhood conservation across species

  • Evolutionary rate analysis:

    • Calculate selective pressure (dN/dS ratios) across different lineages

    • Identify sites under positive selection that might indicate functional adaptation

    • Compare evolutionary rates with those of characterized proteins

This approach can reveal whether ywcB represents a conserved ancestral function or has evolved specialized roles in B. subtilis and closely related species.

How should I design experiments to investigate potential redundancy between ywcB and other uncharacterized B. subtilis proteins?

Functional redundancy is common in bacterial systems, as seen with RNA pyrophosphohydrolases in B. subtilis . To investigate redundancy involving ywcB:

  • Systematic gene deletion approach:

    • Create single, double, and multiple gene deletions of ywcB and related proteins

    • Analyze phenotypes under various conditions to identify synthetic interactions

    • Look for compensatory transcriptional responses using RNA-seq

  • Overexpression rescue experiments:

    • Test if ywcB overexpression can rescue phenotypes in strains lacking related proteins

    • Express ywcB under control of inducible promoters at varying levels to identify threshold effects

  • Domain swapping:

    • Create chimeric proteins between ywcB and potential functionally redundant proteins

    • Map functional domains through complementation analysis

    • Identify critical residues required for specific functions

  • Competition assays:

    • Perform co-culture experiments with wild-type and mutant strains

    • Assess fitness costs of mutations under various environmental conditions

    • Use fluorescent markers to track population dynamics in mixed cultures

This systematic approach can reveal the extent of functional overlap between ywcB and other proteins, providing insights into the robustness of B. subtilis cellular networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.