Recombinant Bacillus subtilis Uncharacterized protein ywdD (ywdD)

Shipped with Ice Packs
In Stock

Description

Putative Membrane Functions

Current knowledge about ywdD's function remains limited, with its role primarily predicted through computational methods rather than direct experimental evidence. The protein is classified as a "putative integral inner membrane protein," suggesting it may play a role in membrane-associated processes in Bacillus subtilis .

Comparative Analysis with Related Proteins

While ywdD itself remains uncharacterized, insights may be gained by examining functionally characterized proteins with similar sequence motifs or structural features. It's important to note that ywdD should not be confused with ywtD, another B. subtilis protein that has been characterized as an enzyme degrading gamma-polyglutamic acid (PGA) . This distinction highlights the importance of precise nomenclature when discussing these bacterial proteins.

Unlike some other uncharacterized proteins in B. subtilis, such as yvdS (which is also a membrane protein but with only 111 amino acids), ywdD has a more substantial size at 211 amino acids, suggesting potentially more complex functional capabilities .

Predicted Functional Partners

One approach to understanding the potential functions of uncharacterized proteins is to examine their predicted interaction partners. According to STRING database analysis, ywdD has several predicted functional partners with varying confidence scores :

Protein PartnerInteraction ScorePartner Function
ywdE0.852Putative integral inner membrane protein
ywzG0.828Putative transcriptional regulator, PadR family
pdxK0.527Pyridoxine, pyridoxal, and pyridoxamine kinase
ywdF0.465Putative glycosyltransferase
ung0.446Uracil-DNA glycosylase

These predicted interactions suggest that ywdD may function in a network involving membrane proteins, transcriptional regulation, vitamin B6 metabolism, glycosylation processes, and DNA repair mechanisms .

Significance of ywdE and ywzG Interactions

The strongest predicted interactions of ywdD are with ywdE and ywzG, with confidence scores of 0.852 and 0.828 respectively . The high confidence of these interactions suggests a potentially important functional relationship.

ywdE is also classified as a putative integral inner membrane protein, suggesting these two proteins may work together in a membrane-associated complex or pathway . The proximity of their genes in the B. subtilis genome further supports a functional relationship, as neighboring genes in bacteria often encode proteins involved in the same biological process.

The interaction with ywzG, a putative transcriptional regulator of the PadR family, suggests ywdD might be involved in processes regulated by this transcription factor . PadR family regulators are known to control various cellular processes, including stress responses and antibiotic resistance, providing a potential clue to ywdD's physiological role.

Expression Systems for ywdD Production

Recombinant production of ywdD has been achieved using Escherichia coli as the expression host . This approach is consistent with the broader trend in biotechnology where E. coli serves as a workhorse for recombinant protein production, even for proteins from Gram-positive organisms like B. subtilis.

For research applications, the full-length ywdD protein (1-211 amino acids) is typically produced with an N-terminal histidine tag to facilitate purification . The availability of such recombinant versions enables researchers to study this uncharacterized protein in vitro and potentially elucidate its functions through biochemical and structural analyses.

Research Applications

The availability of recombinant ywdD provides researchers with a valuable tool for investigating the function of this uncharacterized protein. Potential research applications include:

  1. Structural studies to determine the three-dimensional architecture of the protein

  2. Protein-protein interaction assays to validate predicted functional partners

  3. Localization studies to confirm membrane association

  4. Functional assays to test hypothesized activities

  5. Generation of antibodies for immunolocalization and detection

Such studies would contribute significantly to understanding the role of ywdD within the broader context of B. subtilis biology and potentially reveal novel aspects of bacterial membrane protein function.

Advantages of B. subtilis as an Expression System

While recombinant ywdD is typically produced in E. coli, it's worth noting that B. subtilis itself is an excellent host for recombinant protein production. B. subtilis has a GRAS (Generally Recognized As Safe) status and possesses a remarkable ability to absorb and incorporate exogenous DNA into its genome, making it an ideal platform for heterologous expression of proteins .

The factors that establish B. subtilis as a valuable expression host include:

  1. Decades of scientific knowledge regarding its biology

  2. Well-developed genetic engineering strategies

  3. Various available plasmids and promoter systems

  4. Capacity for high-level protein secretion

  5. Absence of endotoxins, unlike Gram-negative bacteria

These attributes make B. subtilis a robust system not only for studying its own proteins like ywdD but also for producing diverse recombinant proteins for biotechnological applications.

Current Limitations and Future Perspectives

Despite the progress in characterizing the B. subtilis proteome, many proteins like ywdD remain functionally uncharacterized. The challenges in understanding membrane proteins, in particular, contribute to this knowledge gap. Future research should focus on:

  1. Developing improved methods for membrane protein characterization

  2. Implementing systems biology approaches to understand protein networks

  3. Creating targeted gene deletion and mutation studies

  4. Employing advanced structural biology techniques for membrane proteins

  5. Utilizing comparative genomics across related Bacillus species

These approaches would help overcome current limitations in understanding uncharacterized proteins like ywdD and potentially reveal novel biological functions and applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ywdD; BSU38000; ipa-54d; Uncharacterized protein YwdD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywdD
Target Protein Sequence
MDKETYVSEIKSGLKGLPEGEAMIEEIESHIEHHLFRSFQEGKSEEEAMQTLLQAFGTPT DIVSSFKKIQPVTFRAFLMFHLFCNSALFAVGIAITIMHVWLESPFVQAVWKGISVSVWL ILAAYMIYWVLIGYQGVKEFGKRGEKLVLHTILISMVPNVIFMLVFLFNVIPAALFQSLL TPWFVGTCAFATLLFPLFGRMGCYIGRRQLV
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What approaches are most effective for initial characterization of uncharacterized proteins in B. subtilis?

The most effective approach for characterizing uncharacterized proteins in B. subtilis involves a multi-faceted strategy combining bioinformatics, genetics, and biochemical methods. Begin with bioinformatic analysis to identify conserved domains and potential homologs across bacterial species. Follow with gene knockout studies to determine phenotypic effects, and complementation analysis to confirm gene function. Express and purify the recombinant protein to determine biochemical properties and structural features.

For example, in the case of ywbD, researchers used homology searches to identify it as a candidate methyltransferase. The protein was subsequently cloned, expressed in E. coli with a C-terminal His-tag, and purified to homogeneity using immobilized metal ion affinity chromatography. Methyltransferase activity assays with different RNA substrates confirmed its function as an rRNA methyltransferase .

What is the function of B. subtilis ywbD and how was it determined?

B. subtilis ywbD encodes RlmQ, a 23S rRNA methyltransferase that catalyzes the formation of 7-methylguanosine (m7G) at position 2574 of 23S rRNA . This function was determined through a systematic approach that included:

  • Bioinformatic analysis identifying ywbD as a potential methyltransferase based on homology to known methyltransferases

  • Expression and purification of recombinant ywbD protein

  • In vitro methyltransferase assays using unfractionated RNA from E. coli (which lacks m7G2574)

  • Substrate validation using RNA from B. subtilis ΔywbD strain

  • Gel separation of methylated rRNA to identify the specific target (23S rRNA)

This methodical approach demonstrates how researchers can move from a computational prediction to experimental validation of protein function.

How do experimental systems for B. subtilis protein production compare?

Different experimental systems offer various advantages for B. subtilis protein production:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yield, ease of genetic manipulation, established protocolsLack of proper post-translational modifications for some B. subtilis proteinsProteins without complex folding requirements
B. subtilisNative processing, proper folding of species-specific proteinsLower yields than E. coli, more complex genetic manipulationProteins requiring species-specific folding or modifications
YeastEukaryotic post-translational modifications, good for secreted proteinsMay introduce non-native modificationsComplex proteins that fail to express in bacterial systems

The choice depends on specific research needs. For instance, the YDHD protein from B. subtilis has been successfully expressed in both E. coli and yeast systems, as indicated in product specifications . Similarly, ywbD was successfully expressed in E. coli with sufficient activity for functional characterization .

What are the optimal conditions for expressing and purifying recombinant B. subtilis proteins?

Optimal conditions for expressing and purifying B. subtilis proteins vary based on the specific protein, but general best practices include:

For expression:

  • Expression in E. coli BL21(DE3) or similar strains using pET-based vectors with appropriate tags (His, GST)

  • Induction at OD600 of 0.6-0.8 with 0.1-1.0 mM IPTG

  • Post-induction growth at lower temperatures (16-25°C) to enhance solubility

  • Use of specialized media (e.g., auto-induction) for difficult-to-express proteins

For purification:

  • Lysis in buffer containing appropriate protease inhibitors

  • Initial purification using affinity chromatography (His-tag IMAC is common)

  • Further purification by ion exchange or size exclusion chromatography

  • Buffer optimization to maintain protein stability

The recombinant ywbD protein was successfully purified to "quasi-homogeneity by immobilized metal ion affinity chromatography" using a C-terminal His-tag approach . Similarly, the YDHD protein is commercially available as a His-tagged recombinant protein with purity >80% as determined by SDS-PAGE .

How can one generate and validate knockout mutants for studying B. subtilis uncharacterized proteins?

Generating and validating knockout mutants in B. subtilis involves several key steps:

  • Construct Design: Create a deletion construct with flanking homologous regions and a selectable marker (antibiotic resistance). The pMutin4 system has been successfully used for gene disruption in B. subtilis (as demonstrated for yukE, yukD, yukC, yukB, yueB, and yueC genes) .

  • Transformation: Transform competent B. subtilis cells with the knockout construct. For the ywbD studies, researchers used a methodology according to Yasbin et al. for developing competence and transforming B. subtilis strains .

  • Selection: Select transformants on appropriate antibiotic-containing media.

  • Validation: Confirm gene deletion through:

    • PCR verification of the correct genomic structure

    • DNA sequencing of junction regions

    • RT-PCR to confirm absence of transcript

    • Western blotting to confirm absence of protein

    • Complementation testing to confirm phenotypes are due to the specific gene deletion

  • Phenotypic Analysis: Compare growth rates, morphology, and specific biochemical activities between wild-type and knockout strains.

For example, in the ywbD study, RNA from both wild-type and ΔywbD strains was tested as substrates for the recombinant enzyme, confirming the specific activity and substrate site lost in the knockout strain .

What assays can be used to measure enzymatic activities of uncharacterized B. subtilis proteins?

Several assays can be employed to measure enzymatic activities of previously uncharacterized proteins:

  • Radiolabeled Substrate Assays: For ywbD, researchers used 3H-labeled S-adenosylmethionine (SAM) to detect methyltransferase activity. After incubation, the RNA was separated on a 1% agarose gel to identify which rRNA species was methylated .

  • Spectrophotometric Assays: Monitor changes in absorbance when substrates are converted to products.

  • Fluorescence-Based Assays: Use fluorescently labeled substrates or coupling reactions that produce fluorescent products.

  • HPLC or Mass Spectrometry: Detect and quantify reaction products, particularly useful for modified nucleosides or amino acids.

  • Genetic Complementation: Test if the gene/protein can rescue a deficient phenotype in a knockout strain.

  • Structural Studies: Crystal structures or NMR can provide insights into potential enzymatic mechanisms, as demonstrated with the ykuD protein whose structure was solved at 2.0 Å resolution .

The choice of assay depends on the predicted function of the protein and available resources. For ywbD, the methyltransferase activity was conclusively demonstrated using a combination of genetic approaches (knockout strain) and biochemical assays (radiolabeled SAM) .

How does the function of B. subtilis ywbD differ from its E. coli homolog RlmK?

The B. subtilis ywbD protein (RlmQ) and its E. coli homolog RlmK (part of the bifunctional enzyme RlmKL) show interesting functional divergence despite sequence similarity. Key differences include:

  • Target Site Specificity: ywbD/RlmQ catalyzes m7G formation at position 2574 of 23S rRNA in B. subtilis, whereas RlmK modifies G2069 in E. coli 23S rRNA .

  • Protein Structure: RlmK in E. coli exists as part of a bifunctional enzyme (RlmKL) with an additional m2G2445-forming activity (RlmL). In contrast, ywbD functions as a monofunctional enzyme in B. subtilis .

  • Substrate Recognition: Testing revealed that ywbD can methylate E. coli RNA (which lacks m7G2574), indicating that the enzyme recognizes structural features around this position that are conserved between the species, despite targeting different nucleotides than its E. coli homolog .

This functional divergence highlights the evolutionary plasticity of methyltransferases and demonstrates how homologous proteins can evolve different substrate specificities. Researchers investigating uncharacterized proteins should therefore be cautious about inferring functions based solely on sequence homology.

What structural features contribute to the substrate specificity of B. subtilis proteins?

Structural features that contribute to substrate specificity in B. subtilis proteins can be analyzed through comparative structural biology approaches. While the structure of ywbD has not been specifically detailed in the search results, we can draw insights from the related protein ykuD:

  • Domain Architecture: ykuD contains an N-terminal LysM domain involved in cell wall metabolism and a novel catalytic domain with a highly conserved His/Cys-containing motif. The LysM domain exhibits a βααβ tertiary structure with two α-helices located on the same side of a two-stranded, antiparallel β-sheet .

  • Active Site Composition: The conserved motif in ykuD includes His123, Gly124, Cys139, and Arg131, which are likely involved in catalysis. The stereochemical arrangement of these residues provides insights into potential catalytic mechanisms .

  • Surface Properties: The creation of a double mutant (Lys117Ala/Gln118Ala) in ykuD to reduce surface conformational entropy facilitated crystallization, highlighting the importance of surface properties for protein-protein interactions and crystal formation .

Similar structural analyses of ywbD/RlmQ would be valuable for understanding how it specifically recognizes and modifies G2574 in 23S rRNA.

How do regulatory networks control expression of uncharacterized proteins in B. subtilis?

Understanding regulatory networks controlling expression of uncharacterized proteins requires integrating multiple approaches. While specific information about ywbD regulation is not provided in the search results, insights can be drawn from the regulation of the Esat-6-like secretion system (Ess):

  • Two-Component Systems: The expression of the yukEDCByueBC locus (encoding the Ess) depends on phosphorylated DegU (DegU∼P), the response regulator of the two-component system DegS-DegU. This system regulates important post-exponential-phase processes in B. subtilis, including competence, motility, biofilm formation, and production of degradative enzymes .

  • Growth Phase Dependence: The Ess operates essentially in late stationary growth phase, suggesting temporal regulation of gene expression. YukE, a component of this system, was clearly detected in the supernatant fraction of stationary phase cultures but not in exponentially growing cultures .

  • Strain-Specific Differences: The functioning of the Ess is attenuated in laboratory strain 168 compared to undomesticated strains, indicating that domestication has affected the regulation of certain genes .

This example illustrates the complex regulatory networks that may control uncharacterized proteins and emphasizes the importance of considering growth phase, strain background, and specific environmental conditions when studying protein expression.

What challenges might arise in crystallizing B. subtilis proteins and how can they be overcome?

Crystallizing B. subtilis proteins presents several challenges, as illustrated by experiences with the ykuD protein:

  • Surface Entropy Reduction: The wild-type ykuD protein failed to crystallize despite extensive screening. Researchers successfully applied surface conformational entropy reduction by creating a double mutant (Lys117Ala/Gln118Ala) that yielded high-quality crystals .

  • Domain Mobility: The LysM domain of ykuD showed higher B-factors in certain regions (residues 22 to 36), indicating higher intrinsic mobility of this loop. Furthermore, this domain did not form significant crystal contacts, potentially reducing stability in crystal structures .

  • Expression and Purification Optimization: Obtaining sufficient quantities of properly folded protein often requires testing multiple expression conditions and purification protocols.

  • Crystallization Condition Screening: Extensive screening of crystallization conditions (pH, salt, precipitants) is typically necessary to identify suitable parameters for crystal formation.

  • Co-crystallization with Ligands: Including substrates, products, or inhibitors can stabilize protein conformation and facilitate crystallization.

For researchers studying uncharacterized proteins like ywbD, these insights from the ykuD crystallization experience provide valuable guidance for structural studies.

How can protein-protein and protein-substrate interactions be studied for uncharacterized B. subtilis proteins?

Multiple complementary approaches can be used to study protein-protein and protein-substrate interactions:

  • Co-immunoprecipitation (Co-IP): Identify interacting partners by pulling down the protein of interest along with its binding partners.

  • Bacterial Two-Hybrid Assays: Adapted for bacterial proteins, these assays can identify potential interacting proteins.

  • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics between the protein and potential substrates or partners.

  • Cross-linking Coupled with Mass Spectrometry: Identify proteins in close proximity in vivo.

  • Structural Studies: Crystal structures with bound substrates or partners provide detailed interaction information. For example, the structure of ykuD revealed important insights about its potential catalytic properties and substrate interactions .

  • Biochemical Assays: Direct binding assays using purified components can verify interactions. YukE, for example, was shown to exist as a dimer both in vitro and in vivo, suggesting important protein-protein interactions for its function .

  • Targeted Mutagenesis: Identify key residues involved in interactions through systematic mutation and functional testing.

For studying RNA-binding proteins like ywbD/RlmQ, additional techniques such as RNA electrophoretic mobility shift assays (EMSA) and RNA footprinting can identify specific binding sites and interaction mechanisms.

How do B. subtilis uncharacterized proteins compare to homologs in other bacterial species?

Comparing B. subtilis uncharacterized proteins to homologs in other bacterial species provides evolutionary insights and functional clues:

  • Phylogenetic Distribution: The ywbD protein belongs to COG1092, a family of proteins with m5C and m7G forming activity. Its homolog in E. coli, RlmK, is part of a bifunctional enzyme RlmKL .

  • Functional Divergence: Despite sequence similarity, ywbD/RlmQ and its E. coli homolog RlmK methylate different positions in 23S rRNA (G2574 vs. G2069, respectively), indicating evolutionary divergence in substrate specificity .

  • Conservation of Catalytic Domains: Analysis of protein domains can reveal conserved catalytic residues across species. For instance, the ykuD protein contains a conserved His/Cys-containing motif that is likely catalytically important .

  • Domain Architecture Variations: The LysM domain found in ykuD occurs in enzymes involved in cell wall metabolism across different bacterial species, suggesting functional conservation of this domain .

For researchers studying uncharacterized proteins, these comparative analyses can provide important clues about potential functions and guide experimental design.

What can strain-specific differences teach us about the function of uncharacterized proteins?

Strain-specific differences provide valuable insights into protein function and regulation:

  • Phenotypic Variations: The functioning of the Esat-6-like secretion system differs between laboratory strain 168 and undomesticated B. subtilis strains. YukE secretion was detectable in the undomesticated strain during stationary phase but not in strain 168 .

  • Regulatory Differences: Several DegU∼P-regulated processes, including swarming motility, biofilm formation, and exoprotease production, are partially inhibited in domesticated strains compared to wild strains .

  • Expression Level Variations: Researchers failed to detect significant amounts of YukE in both cellular extracts and culture supernatants of strain 168, regardless of growth phase, suggesting strain-specific differences in expression levels .

  • Growth Phase Dependencies: YukE accumulation in culture medium was observed only in stationary phase cultures of the wild-type strain, not in exponentially growing cultures .

These observations highlight the importance of considering strain background when studying uncharacterized proteins and suggest that regulatory networks may have evolved differently in laboratory-adapted strains versus environmental isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.