Recombinant Bacillus subtilis Uncharacterized protein ywjB (ywjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ywjB; BSU37220; Uncharacterized protein YwjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywjB
Target Protein Sequence
MERKTVLYIAVSLDGMIAKEDGSIDWLDEFEGEGDNGYSDFYQTVDTVILGRSTYEHVKV LTPVFPYQDKTCYVFTGSPDSYQDEHVTFINEGARAFTARLKQEKGSNIWIAGGAELVND FMKEDAIDEFIITVIPVVLGSGIPLFHELTNETKLRLKGTKQFGQAVQLHYVRA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What defines ywjB as an "uncharacterized" protein in B. subtilis?

The protein ywjB is classified as uncharacterized because its specific biological function has not been experimentally validated, despite its identification in the B. subtilis genome. Uncharacterized proteins like ywjB are annotated based on genomic location and sequence data, but lack experimental confirmation of their biochemical activities, cellular roles, structural properties, or interaction partners. In the context of B. subtilis, which has a well-characterized genome with 3,086 protein-coding genes and 215 transcription factors, proteins may remain uncharacterized due to challenges in expression, purification, or functional assays despite comprehensive transcriptional profiling data available for this organism . The COMBREX project and similar initiatives specifically target such proteins to bridge this knowledge gap through systematic experimental characterization of previously uncharacterized gene products .

How can I determine if ywjB has homologs in other bacterial species?

To identify potential homologs of ywjB in other bacterial species, implement the following methodological approach:

  • Sequence-based homology search:

    • Perform BLAST (Basic Local Alignment Search Tool) analysis using the ywjB amino acid sequence against comprehensive databases like NCBI's non-redundant protein database

    • Use position-specific iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Apply HMMER tool with profile hidden Markov models for sensitive sequence similarity detection

  • Domain architecture analysis:

    • Search for conserved domains using tools like Pfam, SMART, or CDD to identify functional elements

    • Analyze the arrangement of identified domains to establish evolutionary relationships

  • Phylogenetic analysis:

    • Align ywjB with identified similar sequences using MUSCLE or MAFFT

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Examine the evolutionary distance to establish orthologous or paralogous relationships

When conducting homology searches, focus particularly on other Gram-positive bacteria, as functional conservation is often stronger within similar bacterial phyla. Note that approximately half of all uncharacterized proteins can be related to experimentally characterized proteins through sequence and domain-composition similarity under various thresholds . Document all findings in a systematic manner, including E-values, percent identity/similarity, and alignment coverage.

What expression systems are most suitable for recombinant production of ywjB in B. subtilis?

For optimal recombinant expression of the ywjB protein in B. subtilis, several complementary expression systems should be considered based on their specific advantages:

  • Autonomous plasmid-based expression systems:

    • pHT series vectors with strong promoters (P43 or PxylA) provide high-copy expression

    • Shuttle vectors (E. coli/B. subtilis) like pMK4 facilitate cloning procedures

    • Temperature-sensitive replicons for controlled expression dynamics

  • Genome-integrated expression systems:

    • amyE or lacA locus integration for stable, single-copy expression

    • thrC integration for maintaining physiological expression levels

    • CRISPR-Cas9 mediated integration for precise genomic positioning

Each system should be evaluated based on your specific research requirements. Plasmid-based systems typically yield higher protein amounts but may introduce metabolic burden, while genome-integrated systems provide more stable expression with potentially lower yields . The secretion capacity of B. subtilis can be leveraged by fusing appropriate signal peptides (e.g., amyQ, aprE) to facilitate extracellular production of ywjB, thereby simplifying purification procedures. Additionally, inducible promoter systems like PxylA (xylose-inducible) or Pspac (IPTG-inducible) allow fine-tuned temporal control of expression . For uncharacterized proteins like ywjB, testing multiple expression configurations is often necessary to identify optimal conditions.

What experimental strategies can determine the subcellular localization of ywjB protein?

To determine the subcellular localization of the ywjB protein in Bacillus subtilis, implement a multi-faceted experimental approach:

  • Fluorescent protein fusion methods:

    • Construct C-terminal and N-terminal GFP/YFP fusions with ywjB

    • Express these constructs under native or controlled promoters

    • Perform live-cell fluorescence microscopy for spatial localization

    • Implement time-lapse imaging to track dynamic localization changes

  • Cellular fractionation coupled with Western blotting:

    • Generate specific antibodies against purified ywjB or use epitope tags

    • Separate B. subtilis cellular compartments (cytoplasm, membrane, cell wall, extracellular)

    • Perform Western blot analysis on each fraction to detect ywjB

    • Quantify relative distribution across fractions

  • Immunogold electron microscopy:

    • Fix and section B. subtilis cells expressing ywjB

    • Label with anti-ywjB primary antibodies and gold-conjugated secondary antibodies

    • Visualize precise subcellular localization at nanometer resolution

This methodological approach mimics successful localization studies of spore coat proteins in B. subtilis, such as SpsI, SpsK, and YtdA, which demonstrated distinct localization patterns during sporulation . When designing fluorescent fusion constructs, verify that protein functionality is preserved by complementation assays. For uncharacterized proteins like ywjB, comparing localization patterns under various growth conditions and stress responses can provide crucial functional insights, as demonstrated in previous B. subtilis studies where protein localization changed during different cellular processes .

How can I optimize purification protocols for recombinant ywjB protein from B. subtilis?

Optimizing purification protocols for the recombinant ywjB protein from Bacillus subtilis requires a systematic approach addressing multiple variables:

  • Affinity tag selection and positioning:

    • Test multiple affinity tags (His6, Strep-tag II, FLAG)

    • Compare N-terminal versus C-terminal tag placement

    • Evaluate the necessity for tag removal using specific proteases (TEV, Factor Xa)

  • Cell lysis optimization:

    • Compare mechanical methods (sonication, French press) with enzymatic approaches (lysozyme treatment)

    • Optimize lysis buffer composition (pH 7.0-8.0, 100-300 mM NaCl, 5-10% glycerol)

    • Include protease inhibitors to prevent degradation

  • Chromatography strategy development:

    Purification StepTechniqueBuffer ConditionsExpected Results
    CaptureIMAC (Ni-NTA)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole>80% purity, >90% recovery
    IntermediateIon Exchange50 mM HEPES pH 7.5, 50-500 mM NaCl gradient>90% purity, >80% recovery
    PolishingSize Exclusion50 mM Tris-HCl pH 7.5, 150 mM NaCl>95% purity, >70% recovery
  • Stability assessment and optimization:

    • Screen various buffer systems (HEPES, Tris, Phosphate)

    • Test stabilizing additives (glycerol, arginine, trehalose)

    • Evaluate optimal pH range and ionic strength

For B. subtilis specifically, utilizing its efficient secretion machinery can simplify purification. By fusing appropriate signal peptides to ywjB, the target protein can be directed to the extracellular medium, significantly reducing contamination by host cell proteins . Document protein yield and purity at each purification step using SDS-PAGE and Western blotting. For an uncharacterized protein like ywjB, it is advisable to perform initial small-scale expression and purification trials before scaling up, as predicting solubility and stability characteristics is challenging without prior characterization data.

What bioinformatic approaches can predict potential functions of ywjB?

To predict potential functions of the uncharacterized protein ywjB, implement a comprehensive bioinformatic analysis pipeline:

  • Sequence-based function prediction:

    • Perform sensitive sequence similarity searches using PSI-BLAST and HHpred

    • Identify conserved motifs using MEME and GLAM2

    • Analyze compositional bias and low-complexity regions using SEG and CAST

    • Apply machine learning-based function prediction tools like DeepFunc and COFACTOR

  • Structural prediction and analysis:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Perform structural alignment with characterized proteins using DALI or TM-align

    • Identify potential binding pockets and active sites using CASTp and POCASA

    • Calculate electrostatic surface potential to infer interaction properties

  • Genomic context analysis:

    • Examine the operonic organization of ywjB in B. subtilis

    • Analyze gene neighborhood conservation across related species

    • Identify potential co-regulated genes using transcriptomic data

    • Apply gene fusion detection to identify functional associations

  • Network-based approaches:

    • Construct protein-protein interaction networks using STRING database

    • Implement guilt-by-association methods based on B. subtilis transcriptional regulatory network

    • Apply Bayesian integration of multiple functional evidence types

This multi-layered approach leverages the expanded transcriptional regulatory network of B. subtilis, which contains 3,086 protein-coding genes, 215 transcription factors, and 4,516 predicted interactions . The function prediction accuracy can be assessed based on recall rates of known interactions, which in previous studies reached 74% with approximately 62% accuracy for novel regulatory edge predictions . For proteins like ywjB that remain uncharacterized despite extensive genomic studies, integrating diverse predictive approaches is essential to generate testable hypotheses for experimental validation.

How can I design a CRISPR-Cas9 knockout system to study ywjB function in B. subtilis?

Designing an effective CRISPR-Cas9 knockout system for studying ywjB function in Bacillus subtilis requires careful planning and optimization:

  • sgRNA design and validation:

    • Identify target sequences within ywjB using tools like CHOPCHOP or E-CRISP

    • Select sgRNAs with minimal off-target effects and optimal GC content (40-60%)

    • Verify sgRNA efficiency using in silico prediction models

    • Clone multiple sgRNAs targeting different regions of ywjB to maximize success

  • Vector construction strategy:

    • Utilize B. subtilis-optimized Cas9 expression vectors

    • Design homology arms (800 bp each) flanking the ywjB gene

    • Include selectable markers such as zeocin resistance between lox71 and lox66 sites for subsequent marker removal

    • Implement an inducible promoter system to control Cas9 expression

  • Transformation and selection protocol:

    • Transform competent B. subtilis cells with the CRISPR-Cas9 construct

    • Select transformants on zeocin-containing media

    • Verify knockouts by colony PCR spanning the deletion junction

    • Sequence verify the deletion site to confirm precise editing

  • Phenotypic characterization workflow:

    • Compare growth rates of wild-type and ΔywjB strains under various conditions

    • Analyze transcriptomic changes using RNA-Seq to identify affected pathways

    • Perform complementation studies to confirm phenotype specificity

    • Test environmental stress responses to identify condition-specific functions

This knockout strategy is based on methods described for generating B. subtilis gene knockouts, including the fusion PCR approach using upstream and downstream sequences of approximately 800 bp each . For robust verification of knockout strains, implement both PCR-based genotyping and phenotypic assays. Additionally, consider creating a conditional knockout if ywjB is suspected to be essential, using an IPTG-inducible promoter to control expression levels before attempting complete gene deletion.

What approaches can identify potential interaction partners of ywjB protein in vivo?

To identify potential interaction partners of the ywjB protein in vivo, implement a comprehensive interactomics strategy combining complementary techniques:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Generate B. subtilis strains expressing chromosomally integrated ywjB-FLAG or ywjB-SPA tag fusions

    • Perform crosslinking with formaldehyde to capture transient interactions

    • Isolate protein complexes using anti-FLAG magnetic beads

    • Identify interaction partners using LC-MS/MS analysis

    • Compare results to control purifications to filter out non-specific interactions

  • Bacterial two-hybrid (B2H) screening:

    • Create a fusion of ywjB with the T25 domain of adenylate cyclase

    • Screen against a B. subtilis genomic library fused to the T18 domain

    • Detect positive interactions through cAMP-dependent reporter activation

    • Validate positive hits through reciprocal B2H assays

  • Proximity-dependent biotin identification (BioID):

    • Generate a fusion of ywjB with a promiscuous biotin ligase (BirA*)

    • Express the fusion protein in B. subtilis under native or controlled conditions

    • Allow in vivo biotinylation of proximal proteins

    • Isolate biotinylated proteins using streptavidin affinity purification

    • Identify proximity partners by mass spectrometry

  • Transcriptional regulatory network integration:

    • Analyze the position of ywjB in the reconstructed B. subtilis transcriptional regulatory network

    • Identify potential functional associations based on co-regulation patterns

    • Validate predicted interactions using targeted protein-protein interaction assays

This multi-method approach is supported by successful interactome studies in B. subtilis, which have identified novel regulatory interactions with a validation rate of 62% for predicted novel edges . When analyzing potential interaction partners, prioritize proteins that appear in multiple independent assays and show functional relevance based on co-expression data or phenotypic similarities. For uncharacterized proteins like ywjB, interaction mapping provides crucial insights into its functional context within cellular networks.

How can I design experiments to test if ywjB is involved in sporulation in B. subtilis?

To investigate whether the uncharacterized protein ywjB is involved in the sporulation process of Bacillus subtilis, implement a systematic experimental approach:

  • Expression profiling during sporulation:

    • Construct a ywjB promoter-reporter fusion (PywjB-gfp or PywjB-lacZ)

    • Monitor expression levels throughout the sporulation timeline (0-8 hours)

    • Compare expression patterns with known sporulation genes

    • Determine if ywjB expression correlates with specific sporulation stages

  • Sporulation efficiency assessment:

    • Create a clean ywjB deletion mutant (ΔywjB)

    • Induce sporulation in wild-type and ΔywjB strains

    • Quantify sporulation efficiency by:

      • Heat resistance assays (80°C for 20 minutes)

      • Microscopic enumeration of phase-bright spores

      • Dipicolinic acid (DPA) content measurement

  • Spore property characterization:

    • Evaluate resistance properties of ΔywjB spores to:

      • Heat (80-100°C for various time periods)

      • Chemicals (ethanol, chloroform, lysozyme)

      • UV radiation and desiccation

    • Assess spore germination rates and efficiency

    • Perform spore adhesion assays to test surface properties

  • Localization studies during sporulation:

    • Create fluorescent protein fusions (ywjB-YFP)

    • Perform time-course fluorescence microscopy during sporulation

    • Co-visualize with known sporulation protein markers (e.g., SpsM-CFP)

    • Determine if ywjB localizes to specific sporulation structures

This experimental design is based on successful approaches used to characterize novel sporulation proteins in B. subtilis, such as SpsI, SpsK, YtdA, SpsM, and YfnH, which were identified as components of spore polysaccharide synthesis pathways . The spore adhesion assay should be performed similar to previously described methods, where spore surface hydrophilicity/hydrophobicity was assessed by adherence to glass tubes . For precise temporal resolution of expression patterns, collect samples at 30-minute intervals throughout sporulation, as this sampling frequency has proven effective in previous B. subtilis transcriptional profiling studies .

How can I analyze RNA-Seq data to identify conditions affecting ywjB expression?

To effectively analyze RNA-Seq data for identifying conditions that affect ywjB expression, implement this comprehensive analytical framework:

  • Data preprocessing and quality control:

    • Perform quality assessment of raw reads using FastQC

    • Trim adaptors and low-quality bases using Trimmomatic or Cutadapt

    • Filter out rRNA reads using SortMeRNA

    • Align processed reads to the B. subtilis genome using HISAT2 or STAR

    • Generate count tables using featureCounts or HTSeq

  • Differential expression analysis:

    • Normalize count data using DESeq2 or edgeR

    • Calculate differential expression of ywjB across experimental conditions

    • Apply appropriate statistical thresholds (FDR < 0.05, |log₂FC| > 1)

    • Visualize expression changes using MA plots and heatmaps

  • Co-expression network analysis:

    • Construct gene co-expression networks using WGCNA

    • Identify modules of co-expressed genes containing ywjB

    • Calculate eigengene values for modules of interest

    • Correlate module patterns with experimental conditions

  • Integration with transcriptional regulatory network:

    Analysis ApproachMethodKey ParametersOutput
    TF binding site predictionMEME/FIMOp-value < 0.0001Potential regulatory elements in ywjB promoter
    Network component analysisNCAConvergence threshold < 10⁻⁶Predicted TF activities affecting ywjB
    Regulatory network inferenceGENIE3/ARACNEMinimum mutual information > 0.5Novel regulatory connections for ywjB

This analytical pipeline draws from approaches used in constructing the B. subtilis global transcriptional regulatory network, which successfully predicted 2,258 novel regulatory interactions with 62% accuracy . When analyzing RNA-Seq data for B. subtilis, incorporate time-series designs where appropriate, as these improve the ability to infer directed regulatory edges . To maximize insights, compare your ywjB expression data against comprehensive transcriptomic datasets available for B. subtilis, such as the 38 separate experimental designs covering an entire life cycle from spore germination to sporulation with 30-minute interval sampling .

What statistical approaches can detect subtle phenotypic effects in ywjB mutant strains?

To detect subtle phenotypic effects in ywjB mutant strains that might be missed by conventional analyses, implement these advanced statistical and experimental approaches:

  • High-dimensional phenotyping with multivariate analysis:

    • Collect multiple phenotypic measurements simultaneously (growth rates, metabolite levels, morphological parameters)

    • Apply principal component analysis (PCA) to reduce dimensionality

    • Perform multivariate analysis of variance (MANOVA) to detect global differences

    • Use discriminant analysis to identify the most differentiating phenotypic variables

  • Time-series analysis for dynamic phenotypes:

    • Record phenotypic measurements at multiple time points

    • Apply functional data analysis to compare growth curves

    • Implement dynamic time warping to align developmental trajectories

    • Use longitudinal mixed-effects models to account for repeated measures

  • High-throughput microscopy with image analysis:

    • Perform automated microscopy of wild-type and ΔywjB strains

    • Extract multiple cellular features (size, shape, fluorescence distribution)

    • Apply machine learning classifiers to detect subtle morphological differences

    • Validate findings with targeted follow-up experiments

  • Statistical power enhancement strategies:

    • Increase biological replicates (minimum n=6 for subtle phenotypes)

    • Implement matched-pair designs to reduce variability

    • Apply false discovery rate correction for multiple testing

    • Consider Bayesian approaches to incorporate prior knowledge

These approaches are particularly valuable for uncharacterized proteins like ywjB, where the phenotypic effects may be condition-specific or masked by compensatory mechanisms. When designing experiments, include both negative controls (wild-type) and positive controls (strains with mutations in functionally related genes) to establish the sensitivity of your detection methods. B. subtilis chassis cell engineering studies have demonstrated that subtle changes in cell physiological morphology can be achieved by regulating chronological and replicative lifespans, providing a model for detecting similar subtle effects in your ywjB mutant analysis .

How can I integrate proteomics and transcriptomics data to understand ywjB regulation and function?

To effectively integrate proteomics and transcriptomics data for understanding ywjB regulation and function, implement this multi-layered analytical framework:

  • Data collection and preprocessing:

    • Generate matching RNA-Seq and proteomics datasets from identical conditions

    • Process RNA-Seq data through standard pipelines for quantification

    • Normalize proteomics data using appropriate methods (e.g., total ion current)

    • Match protein IDs with corresponding gene IDs for integrated analysis

  • Correlation analysis and discrepancy identification:

    • Calculate genome-wide mRNA-protein correlation coefficients

    • Identify genes/proteins with discordant expression patterns

    • Position ywjB within the correlation distribution

    • Investigate factors causing mRNA-protein discrepancies for ywjB:

      • Post-transcriptional regulation

      • Protein stability differences

      • Technical biases in measurement

  • Regulatory network reconstruction:

    • Apply network component analysis to simultaneously estimate transcription factor activities

    • Infer post-transcriptional regulatory mechanisms

    • Identify potential regulators of ywjB at both transcriptional and post-transcriptional levels

    • Validate key regulatory interactions experimentally

  • Functional module identification:

    • Perform weighted gene co-expression network analysis for transcriptomics data

    • Conduct protein co-abundance network analysis for proteomics data

    • Compare module memberships between the two networks

    • Identify functional modules containing ywjB and their condition-specific activation

This integrative approach is supported by successful reconstruction of the B. subtilis transcriptional regulatory network, which used network component analysis and model selection to simultaneously estimate transcription factor activities while learning an expanded regulatory network . For optimal integration, both datasets should cover multiple experimental conditions, including stress responses and developmental transitions, to capture the dynamic nature of regulation. The integrated approach should target not only correlation patterns but also causal relationships, potentially revealing whether ywjB is primarily regulated at the transcriptional or post-transcriptional level.

How can I design a comprehensive mutagenesis strategy to identify critical residues in ywjB?

To identify critical functional residues in the uncharacterized protein ywjB, implement this comprehensive mutagenesis strategy:

  • In silico analysis for targeted mutagenesis:

    • Generate structural predictions using AlphaFold2

    • Identify conserved residues through multiple sequence alignments

    • Predict functional sites using computational tools (ConSurf, POOL, ScanNet)

    • Design targeted mutations based on:

      • Evolutionary conservation

      • Predicted structural importance

      • Potential catalytic or binding sites

  • Scanning mutagenesis approaches:

    • Perform alanine scanning of conserved regions

    • Conduct cysteine scanning for accessibility studies

    • Implement charge-reversal mutations for surface residues

    • Design tailored substitutions based on physicochemical properties

  • High-throughput mutagenesis strategies:

    Mutagenesis MethodScopeAdvantagesTechnical Considerations
    Error-prone PCRWhole geneComprehensive coverageVariable mutation frequency
    Site-saturation mutagenesisSpecific residuesAll possible amino acids at key positionsRequires efficient screening
    CRISPR-based saturation editingMultiple sitesIn vivo relevanceDesign of guide RNAs and repair templates
    Deep mutational scanningWhole proteinQuantitative fitness effectsHigh-throughput sequencing required
  • Phenotypic screening pipeline:

    • Design assays to detect functional changes (activity, stability, interactions)

    • Implement hierarchical screening approaches (survival → growth → specific activity)

    • Develop high-throughput screening methods when possible

    • Validate critical residues through complementary biochemical assays

This mutagenesis strategy draws upon established approaches for functional characterization while adapting them to the specific challenges of an uncharacterized protein. When implementing this strategy for ywjB in B. subtilis, leverage the efficient genetic manipulation systems available for this organism, including the knockout methods using fusion PCR with 800 bp homology arms and selectable markers between lox71 and lox66 sites . For comprehensive analysis, combine computational predictions with experimental validation, prioritizing evolutionarily conserved regions that are likely to be functionally important.

What techniques can determine if ywjB forms oligomeric structures in solution?

To determine whether the uncharacterized protein ywjB forms oligomeric structures in solution, implement this multi-technique analytical approach:

  • Hydrodynamic and light scattering techniques:

    • Perform size exclusion chromatography (SEC) to separate oligomeric species

    • Combine SEC with multi-angle light scattering (SEC-MALS) for absolute molecular weight determination

    • Implement analytical ultracentrifugation (AUC):

      • Sedimentation velocity experiments to detect heterogeneity

      • Sedimentation equilibrium for accurate mass determination

    • Use dynamic light scattering (DLS) to measure particle size distribution

  • Structural biology approaches:

    • Apply small-angle X-ray scattering (SAXS) to determine:

      • Radius of gyration

      • Maximum particle dimension

      • Low-resolution molecular envelope

    • Perform negative-stain electron microscopy for direct visualization

    • Consider cryo-EM for high-resolution structural determination

    • Implement cross-linking mass spectrometry to identify subunit interfaces

  • Biochemical and biophysical methods:

    • Conduct chemical cross-linking experiments with:

      • Glutaraldehyde (non-specific)

      • BS3 or DSS (amine-specific)

      • EDC (carboxyl and amine cross-linker)

    • Perform native PAGE electrophoresis

    • Use fluorescence anisotropy to detect changes in rotational diffusion

    • Apply isothermal titration calorimetry (ITC) for self-association studies

  • In vivo approaches:

    • Implement FRET between differently tagged ywjB variants

    • Use genetic complementation with split reporters

    • Perform bacterial two-hybrid assays with ywjB as both bait and prey

For optimal results, purify ywjB under conditions that preserve native interactions, testing multiple buffer systems with varying ionic strengths and pH values. Compare results across different techniques to build a consistent model of oligomerization. Consider examining oligomerization under different physiological conditions relevant to B. subtilis, as protein-protein interactions may be regulated by growth phase or stress conditions. This approach has been successfully applied to characterize protein complexes in B. subtilis, including those involved in sporulation and stress responses .

How can I determine if ywjB undergoes post-translational modifications in B. subtilis?

To comprehensively investigate potential post-translational modifications (PTMs) of the ywjB protein in Bacillus subtilis, implement this systematic analytical approach:

  • Mass spectrometry-based PTM mapping:

    • Purify native ywjB from B. subtilis using immunoprecipitation

    • Perform bottom-up proteomics analysis:

      • Digest with multiple proteases (trypsin, chymotrypsin, Glu-C)

      • Analyze peptides using high-resolution LC-MS/MS

      • Apply PTM-specific fragmentation methods (ETD/EThcD)

    • Implement targeted analysis for common bacterial PTMs:

      • Phosphorylation (Ser/Thr/Tyr)

      • Methylation

      • Acetylation

      • Glycosylation

  • Gel-based PTM detection methods:

    • Perform Phos-tag SDS-PAGE for phosphorylation

    • Use Pro-Q Diamond staining to detect phosphoproteins

    • Apply western blotting with PTM-specific antibodies:

      • Anti-phospho-Ser/Thr/Tyr

      • Anti-acetyl-Lys

      • Anti-methyl-Lys/Arg

  • Enzymatic treatments and mobility shift assays:

    • Treat purified ywjB with:

      • Phosphatases (Lambda, Alkaline)

      • Deacetylases (CobB, HDAC)

      • Deglycosylation enzymes (PNGase F, O-glycosidases)

    • Analyze mobility shifts by SDS-PAGE

  • In vivo PTM dynamics analysis:

    • Culture B. subtilis under various conditions (nutrient limitation, stress, sporulation)

    • Monitor changes in ywjB modification patterns

    • Correlate modifications with specific cellular states or developmental stages

    • Generate site-specific mutants of modified residues to assess functional importance

This comprehensive approach draws upon techniques successfully applied to characterize PTMs in B. subtilis proteins. When analyzing potential modifications of ywjB, consider the biological context and cellular conditions that might trigger specific modifications. For instance, during sporulation, B. subtilis employs extensive phosphorylation networks, while stress responses may involve other modification types . The functional significance of identified modifications should be validated through site-directed mutagenesis, replacing modifiable residues with non-modifiable variants (e.g., Ser→Ala for phosphorylation sites) and assessing the impact on protein function, localization, or stability.

What strategies can improve soluble expression of ywjB for structural studies?

To enhance soluble expression of the uncharacterized protein ywjB for structural studies, implement this comprehensive optimization strategy:

  • Expression system and strain engineering:

    • Test multiple B. subtilis expression strains:

      • WB800 (8 protease deletions)

      • BRB08 (deficient in cell wall turnover)

      • CRE15 (engineered chassis with enhanced lifespan)

    • Optimize codon usage for highly expressed B. subtilis genes

    • Consider modifying the chassis cell using lifespan engineering strategies to enhance biomass and physiological properties

  • Fusion partner screening:

    • Test solubility-enhancing tags:

      • Thioredoxin (TrxA)

      • Maltose-binding protein (MBP)

      • SUMO

      • B. subtilis-specific tags (e.g., YocH)

    • Implement tag removal strategies using specific proteases

    • Optimize linker length and composition between ywjB and fusion partners

  • Expression condition optimization:

    ParameterVariables to TestMonitoring MethodExpected Outcome
    Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blotLower temperatures often enhance solubility
    Induction timingEarly-log, mid-log, late-logGrowth curves, protein yieldPhase-dependent optimization
    Inducer concentration0.1-1.0% xylose or 0.01-1.0 mM IPTGDose-response analysisOptimal expression level without aggregation
    Media compositionLB, 2×YT, minimal media with supplementsBiomass, protein yieldMedia-specific solubility enhancement
  • Co-expression strategies:

    • Implement co-expression of molecular chaperones:

      • GroEL-GroES system

      • DnaK-DnaJ-GrpE system

    • Co-express potential binding partners if identified

    • Consider co-expression of B. subtilis-specific folding factors

This optimization strategy incorporates aspects of B. subtilis strain engineering and expression system design from established protocols for recombinant protein production . When optimizing ywjB expression, consider implementing a Design of Experiments (DoE) approach to systematically evaluate multiple parameters simultaneously rather than one-at-a-time optimization. Additionally, the recent advances in chassis cell engineering using lifespan manipulation techniques have demonstrated significant improvements in protein production capabilities, with some engineered strains showing nearly 2-fold increases in enzyme activity compared to wild-type B. subtilis .

How can I design a high-throughput screening assay to identify potential substrates or ligands for ywjB?

To design an effective high-throughput screening assay for identifying potential substrates or ligands of the uncharacterized protein ywjB, implement this systematic approach:

  • Binding-based screening platforms:

    • Develop a thermal shift assay (Thermofluor/DSF):

      • Screen compound libraries for those that stabilize ywjB

      • Monitor melting temperature shifts using SYPRO Orange

      • Implement in 96 or 384-well format for throughput

    • Establish microscale thermophoresis (MST) screening:

      • Label ywjB with fluorescent dye

      • Measure changes in thermophoretic movement upon ligand binding

      • Screen metabolite libraries and cellular extracts

  • Activity-based screening approaches:

    • Design coupled enzyme assays:

      • Link potential enzymatic activity to detectable output

      • Monitor NAD(P)H production/consumption spectrophotometrically

      • Use specific dyes for detecting various reaction products

    • Implement chemical proteomics:

      • Synthesize activity-based probes targeting potential catalytic residues

      • Identify covalent interactions via click chemistry and MS detection

      • Profile reactivity across different cellular conditions

  • Cell-based screening systems:

    • Develop a bacterial two-hybrid system:

      • Fuse ywjB to one domain of a split reporter

      • Screen against genomic library or metabolite-binding domains

      • Monitor reporter activation upon successful interaction

    • Implement genetic selection strategies:

      • Design synthetic genetic circuits dependent on ywjB activity

      • Link potential functions to growth/survival phenotypes

      • Screen under various environmental conditions

  • Metabolomics-guided approaches:

    • Compare metabolite profiles between wild-type and ΔywjB strains

    • Identify differentially abundant metabolites as potential substrates

    • Validate direct interactions using purified components

    • Trace isotope-labeled metabolites to determine pathway connections

This comprehensive screening strategy combines both in vitro and in vivo approaches to maximize the chances of identifying ywjB substrates or ligands. When implementing these assays, include appropriate positive and negative controls to establish assay performance metrics. The sensitivity of these screening approaches is particularly important for uncharacterized proteins like ywjB, where the nature of potential substrates or ligands is unknown, and interaction affinities may vary widely. High-throughput approaches have been successfully applied in B. subtilis for functional characterization, with transcriptional profiling under 38 separate experimental conditions proving effective for inferring protein functions .

What experimental frameworks can address data contradictions in ywjB functional studies?

  • Source identification and verification:

    • Catalog all contradictory observations with detailed metadata

    • Verify experimental reproducibility within each laboratory

    • Implement standardized protocols across research groups

    • Assess methodological differences that might explain contradictions:

      • Strain background variations

      • Growth condition differences

      • Assay sensitivity disparities

      • Data analysis pipeline variations

  • Orthogonal experimental approaches:

    • Design experiments using independent methodologies to test the same hypothesis

    • Implement complementary techniques with different underlying principles

    • Apply both in vivo and in vitro approaches when feasible

    • Corroborate findings across multiple environmental conditions

  • Collaborative cross-validation:

    • Establish material exchange between laboratories (strains, plasmids, reagents)

    • Perform blind replication studies with standardized protocols

    • Implement round-robin testing across multiple research groups

    • Organize data integration workshops to resolve methodological discrepancies

  • Systematic hypothesis refinement:

    Contradiction TypeResolution ApproachExample ImplementationExpected Outcome
    Functional assignmentCondition-specific testingEvaluate ywjB function across growth phases and stress conditionsFunction may be condition-dependent
    Localization discrepanciesMulti-tag approachCompare N-terminal vs. C-terminal tags, multiple fluorophoresIdentify tag interference artifacts
    Interaction partner conflictsAffinity-based validationImplement multiple co-IP methods with varying stringencyDefine confidence levels for interactions
    Phenotypic inconsistenciesGenetic background analysisTest in multiple B. subtilis strains (168, PY79, NCIB3610)Strain-specific modifiers may exist

This framework draws from successful approaches used to resolve contradictions in previous B. subtilis studies, where reconciling data from different strain backgrounds and experimental conditions was necessary . When addressing contradictions specifically in ywjB functional studies, consider the possibility that this uncharacterized protein may have multiple functions that manifest differently under various conditions, similar to the dual localization patterns observed for spore polysaccharide synthesis proteins in B. subtilis, where some components localize to the spore coat while others function in the mother cell cytoplasm .

What are the most promising research directions for further characterization of ywjB in B. subtilis?

Based on current knowledge and methodological capabilities, the most promising research directions for further characterization of the uncharacterized protein ywjB in Bacillus subtilis include:

  • Integration into transcriptional regulatory networks:

    • Position ywjB within the expanded B. subtilis transcriptional regulatory network

    • Identify transcription factors regulating ywjB expression

    • Determine if ywjB itself possesses regulatory functions

    • Apply network component analysis approaches to predict regulatory interactions

  • Developmental role investigation:

    • Characterize ywjB expression and localization throughout the B. subtilis life cycle

    • Focus particularly on sporulation and germination processes

    • Assess potential roles in biofilm formation

    • Examine involvement in stress response pathways

  • Structural biology and mechanistic studies:

    • Determine the three-dimensional structure of ywjB

    • Identify conserved domains and potential active sites

    • Characterize oligomeric states and dynamics

    • Elucidate structure-function relationships through targeted mutagenesis

  • Physiological context determination:

    • Apply chassis cell engineering principles to isolate ywjB function

    • Characterize the phenotypic impact of ywjB deletion across diverse conditions

    • Implement high-sensitivity detection methods for subtle phenotypes

    • Explore condition-specific activities and regulation

These research directions should be prioritized based on preliminary data and resource availability. The most efficient approach would combine computational predictions with targeted experimental validation, similar to successful strategies used in the COMBREX project for characterizing previously uncharacterized bacterial proteins . Additionally, leveraging the extensive transcriptomic data available for B. subtilis, including time series covering entire life cycles from spore germination to sporulation, provides a powerful foundation for generating testable hypotheses about ywjB function .

How can contradictory findings about ywjB function be reconciled through systematic experimentation?

To reconcile contradictory findings regarding ywjB function through systematic experimentation, implement this comprehensive resolution framework:

  • Standardization of experimental systems:

    • Establish a reference strain set for all ywjB studies:

      • Include multiple B. subtilis backgrounds (168, PY79, NCIB3610)

      • Create identical ywjB deletion mutants in each background

      • Develop standardized complementation constructs

    • Define universal growth and testing conditions:

      • Standardize media composition with defined components

      • Establish precise environmental parameters (temperature, aeration)

      • Create timeline protocols for developmental processes

  • Multi-dimensional phenotypic profiling:

    • Implement parallel phenotypic assays across laboratories:

      • Growth kinetics under various conditions

      • Metabolic profiling using standardized platforms

      • Morphological characterization with defined parameters

      • Stress resistance using calibrated challenges

    • Analyze results using standardized data processing pipelines

  • Context-dependent functional framework:

    • Map condition-specific activities of ywjB:

      • Systematically vary environmental conditions

      • Test across developmental stages

      • Examine interactions with specific genetic backgrounds

    • Develop a unified model incorporating contextual dependencies

  • Community-based validation approach:

    • Establish a consortium for ywjB characterization:

      • Distribute identical materials across laboratories

      • Implement blind testing protocols

      • Perform meta-analysis of combined datasets

    • Create a centralized database of experimental results

This systematic approach addresses the challenge of reconciling contradictory findings by acknowledging that protein function can be highly context-dependent. B. subtilis studies have demonstrated that protein functions can vary significantly between growth phases and environmental conditions, with some proteins serving dual roles depending on the cellular context . For instance, proteins involved in spore polysaccharide synthesis have been shown to localize differently and serve distinct functions depending on the developmental stage . By systematically mapping these contextual dependencies for ywjB, seemingly contradictory observations can potentially be integrated into a more comprehensive understanding of this protein's multifaceted roles in B. subtilis physiology.

What computational approaches can integrate diverse experimental data to predict ywjB function?

To predict the function of the uncharacterized protein ywjB by integrating diverse experimental data, implement these advanced computational approaches:

  • Bayesian network integration frameworks:

    • Develop a probabilistic graphical model incorporating:

      • Sequence-based predictions

      • Structural information

      • Interaction data

      • Expression profiles

      • Phenotypic observations

    • Weight evidence based on reliability of methods

    • Calculate confidence scores for functional predictions

    • Identify knowledge gaps for targeted experimentation

  • Machine learning classification strategies:

    • Implement supervised learning for function prediction:

      • Train algorithms on well-characterized B. subtilis proteins

      • Extract features from multiple data types

      • Apply ensemble methods (Random Forests, Gradient Boosting)

      • Validate through cross-validation

    • Apply semi-supervised approaches to leverage unlabeled data

  • Knowledge graph construction and mining:

    • Build a comprehensive knowledge graph for B. subtilis:

      • Connect genes, proteins, pathways, and phenotypes

      • Incorporate literature-derived relationships

      • Include experimental evidence types and confidence scores

    • Apply graph embedding techniques for function prediction

    • Identify subgraphs suggesting functional modules

  • Multi-omics data integration pipelines:

    Data TypeIntegration MethodFeature ExtractionFunctional Insight
    TranscriptomicsCo-expression network analysisModule membership, expression patternsPathway involvement, regulation
    ProteomicsProtein-protein interaction networksInteraction partners, complex membershipPhysical associations, complexes
    MetabolomicsMetabolic flux analysisAffected metabolites, pathway enrichmentBiochemical activities
    PhenomicsPhenotypic signature comparisonGrowth profiles, stress responsesPhysiological roles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.