Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC)

Shipped with Ice Packs
In Stock

Description

Introduction

The protein YwnC is an uncharacterized protein from Bacillus subtilis, often produced via recombinant techniques for research purposes . Bacillus subtilis is a well-studied Gram-positive bacterium known for its ability to efficiently secrete proteins, making it a valuable host for recombinant protein production. Recombinant YwnC is produced using various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . Due to its uncharacterized nature, research on YwnC primarily focuses on determining its function and potential applications.

Characteristics of Bacillus subtilis

Bacillus subtilis is favored in recombinant protein production due to several beneficial traits :

  • Efficient Secretion: B. subtilis has the capability to secrete proteins effectively, simplifying the purification process .

  • High Yield: It can produce recombinant proteins in large quantities, making it suitable for industrial applications .

  • Non-Toxicity: B. subtilis is non-toxic, which is an important consideration for producing proteins for pharmaceutical or food-related uses .

Production of Recombinant YwnC

Recombinant YwnC is typically produced in host organisms like E. coli . The process involves several steps:

  1. Gene Synthesis and Cloning: The ywnC gene is often synthesized and then cloned into a plasmid vector .

  2. Transformation: The plasmid is transformed into a host cell, such as E. coli, which then expresses the YwnC protein .

  3. Expression: The host cells are cultured under conditions that promote high-level expression of the recombinant protein .

  4. Purification: The YwnC protein is then purified from the cell lysate using techniques such as affinity chromatography .

Properties of YwnC

  • Size: YwnC has a size of 50 ug, but other sizes are available .

  • Source: The protein is derived from Bacillus subtilis strain 168 .

  • UniProt Accession Number: The UniProt accession number for YwnC is P71038 .

  • Sequence Length: The protein sequence covers the full length of 127 amino acids .

  • Amino Acid Sequence: The amino acid sequence of YwnC is: MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSAREAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLFSDTYSTY .

Research Applications

While YwnC is currently annotated as an uncharacterized protein, its recombinant form is valuable for research aimed at elucidating its function. Areas of potential research include:

  • Structural Studies: Determining the three-dimensional structure of YwnC to gain insights into potential functions.

  • Interaction Studies: Identifying other proteins or molecules that interact with YwnC to understand its role in cellular processes.

  • Phenotype Analysis: Investigating the effects of YwnC overexpression or knockout on Bacillus subtilis phenotypes.

Expression and Antimicrobial Activity

Bacillus subtilis can be engineered to express proteins with antimicrobial activity. For instance, a recombinant B. subtilis strain was engineered to express a fusion peptide of porcine β-defensin-2 (pBD-2) and cecropin P1 (CP1), demonstrating antimicrobial activity against various bacteria. This shows the potential of using B. subtilis to produce recombinant proteins with specific functions .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, specific tag requests can be accommodated; please specify your requirements to allow for preferential development.
Synonyms
ywnC; BSU36610; Uncharacterized protein YwnC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywnC
Target Protein Sequence
MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF SDTYSTY
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU36610

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ywnC protein and why is it classified as "uncharacterized"?

The ywnC protein is a hypothetical protein from Bacillus subtilis with the gene ID 936950 and UniProt ID P71038. It is classified as "uncharacterized" because its precise biological function, three-dimensional structure, and role in cellular processes have not yet been fully elucidated through experimental methods. Like many hypothetical proteins, it has been identified through genomic sequencing and computational analysis, but lacks experimental validation of its function within the bacterial cell .

What are the basic specifications of recombinant Bacillus subtilis ywnC protein?

Recombinant Bacillus subtilis ywnC protein is typically expressed in E. coli or yeast expression systems and provided with a His-tag for purification purposes. The commercially available product specifications include:

  • Purity: > 80% by SDS-PAGE analysis

  • Endotoxin content: < 1.0 EU per μg of protein (determined by LAL method)

  • Form: Available as liquid or lyophilized powder

  • Storage buffer: PBS buffer

  • Storage conditions: +4°C for short term; -20°C to -80°C for long term storage

What expression systems are typically used for producing recombinant ywnC protein?

Recombinant ywnC protein is primarily expressed using either E. coli or yeast expression systems. The choice between these systems depends on several factors including desired post-translational modifications, protein solubility, yield requirements, and downstream applications. E. coli systems generally provide higher yields and simpler purification processes, while yeast systems may offer better protein folding for complex proteins. For ywnC specifically, both systems have been successfully employed to produce the recombinant protein with His-tag modifications .

How should researchers design experiments to determine the function of uncharacterized proteins like ywnC?

Determining the function of uncharacterized proteins like ywnC requires a multifaceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction using tools like AlphaFold

    • Identification of conserved domains and motifs

  • Experimental verification:

    • Gene knockout or knockdown studies to observe phenotypic changes

    • Protein-protein interaction studies (pull-down assays, yeast two-hybrid)

    • Subcellular localization using fluorescence microscopy

    • Comparative transcriptomics and proteomics between wild-type and mutant strains

  • Biochemical characterization:

    • Substrate specificity assays if enzymatic activity is suspected

    • Binding assays to identify potential ligands or interacting partners

    • Structural studies using X-ray crystallography or NMR

Similar approaches have been used successfully for other Bacillus subtilis proteins, such as the aldo-keto reductases YvgN and YtbE, which were initially uncharacterized but later determined to have roles in bacterial detoxification through crystallographic and enzymatic analyses .

What are the optimal purification methods for recombinant His-tagged ywnC protein?

Purification of His-tagged ywnC protein typically follows this methodological workflow:

  • Cell lysis: Sonication or pressure-based disruption in buffer containing protease inhibitors

  • Clarification: Centrifugation at 12,000-15,000g for 30 minutes to separate soluble proteins

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Nickel or cobalt-charged resin columns

    • Binding buffer: typically 20-50 mM Tris-HCl, pH 7.5-8.0, 300-500 mM NaCl, 10-20 mM imidazole

    • Washing: Gradually increasing imidazole concentration (20-50 mM)

    • Elution: Higher imidazole concentration (250-500 mM)

  • Size exclusion chromatography: For higher purity requirements and to ensure monomeric state

  • Buffer exchange: Into PBS or other storage buffer using dialysis or desalting columns

  • Quality control: SDS-PAGE analysis (>80% purity) and endotoxin testing (<1.0 EU/μg)

What considerations should be taken when designing experimental controls for ywnC functional studies?

Proper experimental controls are critical when studying uncharacterized proteins like ywnC:

  • Positive controls:

    • Use well-characterized proteins from the same organism (like YvgN and YtbE in B. subtilis) for comparative analysis

    • Include known functional domains in parallel experiments if homology suggests similar function

  • Negative controls:

    • Empty vector expressions for background assessment

    • Heat-inactivated protein preparations to control for non-specific effects

    • Tag-only proteins to account for tag interference in functional assays

  • Genetic controls:

    • Complementation studies with the ywnC gene to confirm phenotype restoration

    • Expression of ywnC homologs from related species to assess functional conservation

  • Experimental validations:

    • Multiple experimental techniques to confirm the same finding

    • Biological replicates with statistical analysis

    • Alternative tag positions (N-terminal vs. C-terminal) to control for tag interference with function

How might researchers determine if ywnC plays a role in RNA metabolism like other B. subtilis proteins?

Given the importance of RNA metabolism in B. subtilis, investigating ywnC's potential involvement requires specialized approaches:

  • RNA-protein interaction studies:

    • RNA immunoprecipitation (RIP) using anti-His antibodies for tagged ywnC

    • Electrophoretic mobility shift assays (EMSA) with various RNA substrates

    • UV crosslinking studies to identify direct RNA binding

  • Comparative genomics with RNA processing proteins:

    • Analysis of genomic context near ywnC for co-localization with known RNA-related genes

    • Evolutionary conservation patterns similar to RNase Y or other RNA processing factors

  • Phenotypic analysis in RNA metabolism contexts:

    • Complementation studies in RNase Y-deficient strains to test for functional overlap

    • RNA stability measurements in ywnC mutant strains

    • mRNA half-life determination in wild-type versus ywnC knockout strains

  • Biochemical assays for RNA processing activity:

    • In vitro RNA degradation assays with purified ywnC

    • Nuclease activity tests with different RNA substrates and cofactors

This methodological approach is inspired by studies on RNase Y, which plays a critical role in RNA metabolism in B. subtilis by controlling mRNA homeostasis .

What structural analysis techniques are most appropriate for elucidating ywnC protein function?

For an uncharacterized protein like ywnC, structural characterization can provide crucial insights into function. The recommended methodological approach includes:

Similar approaches were successfully applied to YvgN and YtbE proteins from B. subtilis, revealing their structures as members of the aldo-keto reductase superfamily and elucidating their cofactor binding mechanisms .

How can ywnC protein be utilized in experimental evolution studies with B. subtilis?

Experimental evolution studies with ywnC could provide insights into protein function development and adaptation:

  • Long-term evolution experiments:

    • Subject B. subtilis strains with modified ywnC expression to selective pressures

    • Monitor phenotypic and genomic changes over hundreds of generations

    • Identify compensatory mutations that arise in response to ywnC modification

  • Experimental setups:

    • Design selection conditions relevant to suspected ywnC function

    • Use hydroponic conditions with plant roots as selective environment

    • Implement serial transfer protocols similar to those used in Arabidopsis thaliana colonization studies

  • Analysis of evolved populations:

    • Whole genome sequencing of evolved isolates

    • Phenotypic characterization of colony morphology changes

    • Transcriptomic analysis to identify altered gene expression patterns

    • Proteomics to detect changes in protein interaction networks

This approach draws inspiration from experimental evolution studies of B. subtilis on Arabidopsis thaliana roots, where genetic adaptations were observed through successive transfers and colonization events .

What are the appropriate methods for analyzing potential genetic interactions between ywnC and other B. subtilis genes?

To investigate genetic interactions involving the ywnC gene:

  • Synthetic genetic array (SGA) analysis:

    • Cross ywnC deletion/modification strains with genome-wide deletion libraries

    • Identify synthetic lethal, sick, or suppressor interactions

    • Quantify growth rates and colony sizes to determine interaction strength

  • Transposon mutagenesis screens:

    • Generate transposon libraries in ywnC-modified backgrounds

    • Identify suppressors or enhancers of ywnC-associated phenotypes

    • Sequence insertion sites to map genetic interaction networks

  • CRISPR-based approaches:

    • Apply CRISPR interference to simultaneously downregulate ywnC and other genes

    • Create combinatorial gene expression libraries

    • Perform pooled fitness assays under various conditions

  • Transcriptome analysis:

    • Compare RNA-seq data between wild-type and ywnC mutant strains

    • Identify differentially expressed genes that may function in the same pathway

    • Perform network analysis to identify gene modules affected by ywnC alteration

Similar approaches have been used to study the genetic interactions of RNase Y in B. subtilis, revealing its cooperation with RNA polymerase in establishing optimal RNA homeostasis .

What are the common challenges in expressing and purifying recombinant ywnC protein and how can they be addressed?

ChallengePotential CausesSolutions
Low expression yieldCodon bias, protein toxicity, improper inductionCodon optimization, use of slower promoters, lower induction temperature (16-25°C), evaluation of alternative expression hosts
Protein insolubilityImproper folding, hydrophobic regions, inclusion body formationAddition of solubility tags (MBP, SUMO), co-expression with chaperones, inclusion body purification followed by refolding
Impaired protein stabilityProtease sensitivity, aggregation tendencyAddition of protease inhibitors, optimization of buffer conditions (pH, salt, additives like glycerol)
Poor His-tag accessibilityTag burial within protein structureMoving tag position (N- to C-terminus or vice versa), using longer linker sequences
Endotoxin contaminationBacterial cell wall components co-purifyingAdditional purification steps (ion exchange, polymyxin B affinity) specifically targeting endotoxin removal

These challenges are common when working with recombinant proteins from B. subtilis and other bacterial sources, and the provided solutions have been validated in similar recombinant protein production scenarios .

How can researchers validate that the recombinant ywnC protein is properly folded and functionally active?

Validation of proper folding and functional activity is critical, particularly for uncharacterized proteins:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Differential scanning fluorimetry (DSF) to assess thermal stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

  • Functional assessment approaches:

    • Enzymatic activity screens with diverse substrate panels

    • Binding assays with predicted interaction partners

    • Cell-based functional complementation assays

  • Comparative analysis:

    • Side-by-side testing with native protein (if available)

    • Comparison with homologs of known function from related species

    • Testing multiple constructs with different tag positions or tag-free versions

  • Structural integrity verification:

    • Limited proteolysis to assess domain folding

    • Hydrogen-deuterium exchange mass spectrometry

    • Intrinsic fluorescence spectroscopy to evaluate tertiary structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.