The protein YwnC is an uncharacterized protein from Bacillus subtilis, often produced via recombinant techniques for research purposes . Bacillus subtilis is a well-studied Gram-positive bacterium known for its ability to efficiently secrete proteins, making it a valuable host for recombinant protein production. Recombinant YwnC is produced using various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . Due to its uncharacterized nature, research on YwnC primarily focuses on determining its function and potential applications.
Bacillus subtilis is favored in recombinant protein production due to several beneficial traits :
Efficient Secretion: B. subtilis has the capability to secrete proteins effectively, simplifying the purification process .
High Yield: It can produce recombinant proteins in large quantities, making it suitable for industrial applications .
Non-Toxicity: B. subtilis is non-toxic, which is an important consideration for producing proteins for pharmaceutical or food-related uses .
Recombinant YwnC is typically produced in host organisms like E. coli . The process involves several steps:
Gene Synthesis and Cloning: The ywnC gene is often synthesized and then cloned into a plasmid vector .
Transformation: The plasmid is transformed into a host cell, such as E. coli, which then expresses the YwnC protein .
Expression: The host cells are cultured under conditions that promote high-level expression of the recombinant protein .
Purification: The YwnC protein is then purified from the cell lysate using techniques such as affinity chromatography .
Size: YwnC has a size of 50 ug, but other sizes are available .
Source: The protein is derived from Bacillus subtilis strain 168 .
UniProt Accession Number: The UniProt accession number for YwnC is P71038 .
Sequence Length: The protein sequence covers the full length of 127 amino acids .
Amino Acid Sequence: The amino acid sequence of YwnC is: MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSAREAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLFSDTYSTY .
While YwnC is currently annotated as an uncharacterized protein, its recombinant form is valuable for research aimed at elucidating its function. Areas of potential research include:
Structural Studies: Determining the three-dimensional structure of YwnC to gain insights into potential functions.
Interaction Studies: Identifying other proteins or molecules that interact with YwnC to understand its role in cellular processes.
Phenotype Analysis: Investigating the effects of YwnC overexpression or knockout on Bacillus subtilis phenotypes.
Bacillus subtilis can be engineered to express proteins with antimicrobial activity. For instance, a recombinant B. subtilis strain was engineered to express a fusion peptide of porcine β-defensin-2 (pBD-2) and cecropin P1 (CP1), demonstrating antimicrobial activity against various bacteria. This shows the potential of using B. subtilis to produce recombinant proteins with specific functions .
KEGG: bsu:BSU36610
The ywnC protein is a hypothetical protein from Bacillus subtilis with the gene ID 936950 and UniProt ID P71038. It is classified as "uncharacterized" because its precise biological function, three-dimensional structure, and role in cellular processes have not yet been fully elucidated through experimental methods. Like many hypothetical proteins, it has been identified through genomic sequencing and computational analysis, but lacks experimental validation of its function within the bacterial cell .
Recombinant Bacillus subtilis ywnC protein is typically expressed in E. coli or yeast expression systems and provided with a His-tag for purification purposes. The commercially available product specifications include:
Purity: > 80% by SDS-PAGE analysis
Endotoxin content: < 1.0 EU per μg of protein (determined by LAL method)
Form: Available as liquid or lyophilized powder
Storage buffer: PBS buffer
Storage conditions: +4°C for short term; -20°C to -80°C for long term storage
Recombinant ywnC protein is primarily expressed using either E. coli or yeast expression systems. The choice between these systems depends on several factors including desired post-translational modifications, protein solubility, yield requirements, and downstream applications. E. coli systems generally provide higher yields and simpler purification processes, while yeast systems may offer better protein folding for complex proteins. For ywnC specifically, both systems have been successfully employed to produce the recombinant protein with His-tag modifications .
Determining the function of uncharacterized proteins like ywnC requires a multifaceted approach:
Bioinformatic analysis:
Sequence homology searches against characterized proteins
Structural prediction using tools like AlphaFold
Identification of conserved domains and motifs
Experimental verification:
Gene knockout or knockdown studies to observe phenotypic changes
Protein-protein interaction studies (pull-down assays, yeast two-hybrid)
Subcellular localization using fluorescence microscopy
Comparative transcriptomics and proteomics between wild-type and mutant strains
Biochemical characterization:
Substrate specificity assays if enzymatic activity is suspected
Binding assays to identify potential ligands or interacting partners
Structural studies using X-ray crystallography or NMR
Similar approaches have been used successfully for other Bacillus subtilis proteins, such as the aldo-keto reductases YvgN and YtbE, which were initially uncharacterized but later determined to have roles in bacterial detoxification through crystallographic and enzymatic analyses .
Purification of His-tagged ywnC protein typically follows this methodological workflow:
Cell lysis: Sonication or pressure-based disruption in buffer containing protease inhibitors
Clarification: Centrifugation at 12,000-15,000g for 30 minutes to separate soluble proteins
Immobilized Metal Affinity Chromatography (IMAC):
Nickel or cobalt-charged resin columns
Binding buffer: typically 20-50 mM Tris-HCl, pH 7.5-8.0, 300-500 mM NaCl, 10-20 mM imidazole
Washing: Gradually increasing imidazole concentration (20-50 mM)
Elution: Higher imidazole concentration (250-500 mM)
Size exclusion chromatography: For higher purity requirements and to ensure monomeric state
Buffer exchange: Into PBS or other storage buffer using dialysis or desalting columns
Quality control: SDS-PAGE analysis (>80% purity) and endotoxin testing (<1.0 EU/μg)
Proper experimental controls are critical when studying uncharacterized proteins like ywnC:
Positive controls:
Use well-characterized proteins from the same organism (like YvgN and YtbE in B. subtilis) for comparative analysis
Include known functional domains in parallel experiments if homology suggests similar function
Negative controls:
Empty vector expressions for background assessment
Heat-inactivated protein preparations to control for non-specific effects
Tag-only proteins to account for tag interference in functional assays
Genetic controls:
Complementation studies with the ywnC gene to confirm phenotype restoration
Expression of ywnC homologs from related species to assess functional conservation
Experimental validations:
Given the importance of RNA metabolism in B. subtilis, investigating ywnC's potential involvement requires specialized approaches:
RNA-protein interaction studies:
RNA immunoprecipitation (RIP) using anti-His antibodies for tagged ywnC
Electrophoretic mobility shift assays (EMSA) with various RNA substrates
UV crosslinking studies to identify direct RNA binding
Comparative genomics with RNA processing proteins:
Analysis of genomic context near ywnC for co-localization with known RNA-related genes
Evolutionary conservation patterns similar to RNase Y or other RNA processing factors
Phenotypic analysis in RNA metabolism contexts:
Complementation studies in RNase Y-deficient strains to test for functional overlap
RNA stability measurements in ywnC mutant strains
mRNA half-life determination in wild-type versus ywnC knockout strains
Biochemical assays for RNA processing activity:
In vitro RNA degradation assays with purified ywnC
Nuclease activity tests with different RNA substrates and cofactors
This methodological approach is inspired by studies on RNase Y, which plays a critical role in RNA metabolism in B. subtilis by controlling mRNA homeostasis .
For an uncharacterized protein like ywnC, structural characterization can provide crucial insights into function. The recommended methodological approach includes:
Similar approaches were successfully applied to YvgN and YtbE proteins from B. subtilis, revealing their structures as members of the aldo-keto reductase superfamily and elucidating their cofactor binding mechanisms .
Experimental evolution studies with ywnC could provide insights into protein function development and adaptation:
Long-term evolution experiments:
Subject B. subtilis strains with modified ywnC expression to selective pressures
Monitor phenotypic and genomic changes over hundreds of generations
Identify compensatory mutations that arise in response to ywnC modification
Experimental setups:
Design selection conditions relevant to suspected ywnC function
Use hydroponic conditions with plant roots as selective environment
Implement serial transfer protocols similar to those used in Arabidopsis thaliana colonization studies
Analysis of evolved populations:
Whole genome sequencing of evolved isolates
Phenotypic characterization of colony morphology changes
Transcriptomic analysis to identify altered gene expression patterns
Proteomics to detect changes in protein interaction networks
This approach draws inspiration from experimental evolution studies of B. subtilis on Arabidopsis thaliana roots, where genetic adaptations were observed through successive transfers and colonization events .
To investigate genetic interactions involving the ywnC gene:
Synthetic genetic array (SGA) analysis:
Cross ywnC deletion/modification strains with genome-wide deletion libraries
Identify synthetic lethal, sick, or suppressor interactions
Quantify growth rates and colony sizes to determine interaction strength
Transposon mutagenesis screens:
Generate transposon libraries in ywnC-modified backgrounds
Identify suppressors or enhancers of ywnC-associated phenotypes
Sequence insertion sites to map genetic interaction networks
CRISPR-based approaches:
Apply CRISPR interference to simultaneously downregulate ywnC and other genes
Create combinatorial gene expression libraries
Perform pooled fitness assays under various conditions
Transcriptome analysis:
Compare RNA-seq data between wild-type and ywnC mutant strains
Identify differentially expressed genes that may function in the same pathway
Perform network analysis to identify gene modules affected by ywnC alteration
Similar approaches have been used to study the genetic interactions of RNase Y in B. subtilis, revealing its cooperation with RNA polymerase in establishing optimal RNA homeostasis .
| Challenge | Potential Causes | Solutions |
|---|---|---|
| Low expression yield | Codon bias, protein toxicity, improper induction | Codon optimization, use of slower promoters, lower induction temperature (16-25°C), evaluation of alternative expression hosts |
| Protein insolubility | Improper folding, hydrophobic regions, inclusion body formation | Addition of solubility tags (MBP, SUMO), co-expression with chaperones, inclusion body purification followed by refolding |
| Impaired protein stability | Protease sensitivity, aggregation tendency | Addition of protease inhibitors, optimization of buffer conditions (pH, salt, additives like glycerol) |
| Poor His-tag accessibility | Tag burial within protein structure | Moving tag position (N- to C-terminus or vice versa), using longer linker sequences |
| Endotoxin contamination | Bacterial cell wall components co-purifying | Additional purification steps (ion exchange, polymyxin B affinity) specifically targeting endotoxin removal |
These challenges are common when working with recombinant proteins from B. subtilis and other bacterial sources, and the provided solutions have been validated in similar recombinant protein production scenarios .
Validation of proper folding and functional activity is critical, particularly for uncharacterized proteins:
Biophysical characterization:
Circular dichroism (CD) spectroscopy to confirm secondary structure elements
Differential scanning fluorimetry (DSF) to assess thermal stability
Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state
Functional assessment approaches:
Enzymatic activity screens with diverse substrate panels
Binding assays with predicted interaction partners
Cell-based functional complementation assays
Comparative analysis:
Side-by-side testing with native protein (if available)
Comparison with homologs of known function from related species
Testing multiple constructs with different tag positions or tag-free versions
Structural integrity verification:
Limited proteolysis to assess domain folding
Hydrogen-deuterium exchange mass spectrometry
Intrinsic fluorescence spectroscopy to evaluate tertiary structure