Recombinant Bacillus subtilis Uncharacterized protein ywoB (ywoB)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus subtilis ywoB Protein

The ywoB protein originates from Bacillus subtilis, a Gram-positive soil bacterium widely used as a model organism in molecular microbiology. This protein is encoded by the ywoB gene, which constitutes the first gene in the ywoBCD operon . While classified as "uncharacterized," the protein has demonstrated specific expression patterns in response to certain antibiotics, suggesting a specialized function in bacterial stress response mechanisms. The recombinant form of this protein is produced through genetic engineering techniques, where the ywoB gene is isolated from B. subtilis and expressed in suitable host systems to generate purified protein for research applications.

Current research indicates that ywoB and its associated operon are selectively induced by a subset of cell wall antibiotics that specifically inhibit lipid II function or recycling in bacterial cell walls . This selective induction pattern distinguishes ywoB from other stress-responsive elements in B. subtilis and highlights its potential specialized role in adapting to specific types of cell envelope stress. As a commercially available recombinant protein, ywoB has become accessible for various research applications, enabling further investigation into its properties and functions.

Operon Organization and Expression

The ywoB gene serves as the first gene in the ywoBCD operon within the Bacillus subtilis genome . This operon exists as a discrete transcriptional unit regulated by specific molecular mechanisms in response to environmental stimuli. Research has demonstrated that the ywoBCD operon, along with the ytrABCDEF operon, is not part of previously characterized antibiotic-responsive regulons in B. subtilis, suggesting it represents a distinct stress response pathway with specialized functions .

The expression of the ywoB operon is tightly regulated by YtrA, a member of the GntR family of transcriptional repressors. YtrA binds to specific inverted repeat sequences in the regulatory regions of both the ytrA and ywoB operons, functioning as a repressor under normal growth conditions . This regulatory mechanism ensures that ywoB expression remains repressed until appropriate stress conditions are encountered.

Transcriptional Regulation Mechanisms

The regulation of ywoB expression occurs through a well-defined molecular mechanism involving the YtrA repressor. Experimental evidence demonstrates that YtrA recognizes and binds to an inverted repeat sequence located in the regulatory region upstream of the ywoB gene . This binding event prevents RNA polymerase access to the promoter region, thereby repressing transcription of the ywoBCD operon under normal growth conditions.

In laboratory investigations, researchers have verified this regulatory relationship through multiple approaches. The ywoB regulatory region has been successfully PCR-amplified (using primers 3734 and 3735 for PywoB), digested with restriction enzymes (EcoRI and BamHI), and cloned into plasmid vectors containing reporter genes . These reporter constructs have been instrumental in demonstrating that YtrA functions as a direct repressor of the ywoB operon and that this repression is alleviated during specific antibiotic stress conditions.

Selective Induction Patterns

One of the most significant findings regarding ywoB involves its selective induction in response to specific cell wall-targeting antibiotics. Comprehensive transcriptional profiling has revealed that the ywoBCD operon, including ywoB, is strongly induced by ramoplanin, a glycolipodepsipeptide antibiotic that inhibits the transglycosylation step of cell wall synthesis by binding to lipid II . This induction pattern differs markedly from the response to moenomycin, another transglycosylation inhibitor that primarily binds to the transglycosylase enzyme rather than lipid II .

Cluster analysis of gene expression data has demonstrated that the ywoBCD and ytrABCDEF operons are selectively induced by a subset of cell wall antibiotics that specifically inhibit lipid II function or recycling . This selective response suggests that ywoB and its associated proteins have evolved to address particular types of cell envelope stress, particularly those affecting lipid II-dependent processes in peptidoglycan synthesis.

Comparison with Other Stress Response Systems

The ywoB-associated stress response differs substantially from other well-characterized stress response systems in B. subtilis. While many antibiotics activate extracytoplasmic function (ECF) sigma factors (such as σM) or two-component regulatory systems (such as LiaRS), the ywoB response represents a distinct pathway specifically activated by certain cell wall stressors . This distinction is illustrated in Table 1, which compares the major stress response systems in B. subtilis and their induction patterns.

Table 1: Comparison of Major Cell Envelope Stress Response Systems in Bacillus subtilis

Response SystemRegulatorsPrimary InducersGenes InducedRole in Antibiotic Resistance
ywoB responseYtrA (repressor)Ramoplanin, antibiotics affecting lipid IIywoBCD operonNot fully characterized
ytrA responseYtrA (repressor)Ramoplanin, antibiotics affecting lipid IIytrABCDEF operonNot fully characterized
ECF sigma factor responseσMMoenomycin, various cell wall antibioticsσM regulon (~60 genes)Protection against various cell wall antibiotics
LiaRS systemLiaR (activator)Ramoplanin, bacitracin, nisinliaIHGSF operonVariable protective effects
YoeB responseUnknownCell wall synthesis inhibitorsyoeBReduces autolysis rate

The selective induction of ywoB by specific antibiotics targeting lipid II function places it in a unique position among stress response elements in B. subtilis. Unlike the broader responses mediated by ECF sigma factors or two-component systems, the ywoB response appears more specialized and targeted toward particular types of cell envelope stress .

Protein Structure and Properties

The selective induction of ywoB by lipid II-targeting antibiotics suggests this protein may interact with components of the peptidoglycan synthesis pathway or function in protective mechanisms against specific types of cell envelope damage. Experimental approaches using the recombinant form of the protein could help elucidate its structural characteristics and biochemical activities.

Potential Functional Mechanisms

While the precise function of ywoB remains to be fully characterized, its induction pattern provides clues about its potential roles. The protein may be involved in:

  1. Protection of lipid II from antibiotic binding

  2. Alternative peptidoglycan synthesis pathways activated during stress

  3. Peptidoglycan remodeling in response to cell wall damage

  4. Sequestration or detoxification of cell wall-targeting antibiotics

  5. Signaling functions in stress response cascades

By comparison, another antibiotic-inducible cell wall-associated protein in B. subtilis, YoeB, has been shown to reduce the rate of autolysis in response to cell wall-targeting antibiotics . YoeB demonstrates weak sequence similarity to a noncatalytic domain of class B penicillin-binding proteins and associates with the cell wall to decrease autolysin activity during cell envelope stress . While direct functional parallels between YoeB and ywoB have not been established, their shared induction by cell wall antibiotics suggests they may participate in related protective mechanisms.

Transcriptional Analysis Techniques

Research on ywoB expression has employed sophisticated transcriptional analysis techniques to characterize its regulation and induction patterns. Microarray analyses have been instrumental in comparing the stimulons (sets of genes whose expression changes in response to a stimulus) of different antibiotics, such as ramoplanin and moenomycin . These analyses have revealed that ramoplanin treatment (5 μg/ml for 10 minutes) strongly induces the ywoB operon, while moenomycin treatment has minimal effect on its expression .

Researchers have isolated RNA from bacterial cultures in mid-log phase (OD600 of 0.4) after antibiotic treatment and conducted microarray analysis in biological triplicates to ensure robust and reproducible results . Fold induction values were calculated by comparing signal intensity values between treated and untreated samples, providing quantitative measures of gene expression changes in response to antibiotics.

Genetic and Biochemical Approaches

Multiple genetic and biochemical approaches have been employed to study ywoB and its regulation:

  1. Promoter fusion constructs: The ywoB regulatory region has been PCR-amplified and cloned into vectors containing reporter genes (such as lacZ) to study its expression patterns .

  2. In vivo and in vitro binding assays: These techniques have demonstrated that YtrA acts as a repressor of both the ytrA and ywoB operons by binding to specific DNA sequences in their regulatory regions .

  3. Recombinant protein production: The availability of recombinant ywoB protein enables biochemical characterization, interaction studies, and functional assays .

These methodologies provide a foundation for future research aimed at fully characterizing the structure, function, and regulatory mechanisms of ywoB and its role in bacterial stress responses.

Relationship to Other Stress Response Pathways

The ywoB protein and its associated operon represent one of several stress response systems in B. subtilis that respond to cell envelope perturbations. While many antibiotics activate multiple stress response pathways simultaneously, the selective induction of ywoB by specific antibiotics distinguishes it from broader stress responses.

In B. subtilis, cell wall stress responses are mediated by several regulatory systems, including seven ECF sigma factors (σM, σW, σX, σY, σV, σZ, and YlaC), the general stress sigma factor (σB), and five cell wall stress-related two-component systems (LiaRS, BceRS, PsdRS, YxdKJ, and YycFG) . The ywoB response represents an additional layer in this complex network of stress adaptation mechanisms.

Evolutionary Conservation and Significance

The selective induction of ywoB by specific antibiotics targeting lipid II suggests evolutionary adaptation to particular types of cell envelope stress. This specialization may reflect the importance of maintaining cell wall integrity under diverse environmental conditions and the evolutionary pressure exerted by natural antibiotics produced by competing microorganisms in soil environments where B. subtilis typically resides.

Potential Applications in Antibiotic Research

Understanding the role of ywoB in the bacterial response to cell wall-targeting antibiotics could have significant implications for antibiotic research. If ywoB contributes to adaptive responses that enhance bacterial survival during antibiotic exposure, it might represent a target for adjuvant therapies designed to enhance antibiotic efficacy. Conversely, if ywoB functions in protecting cellular components from damage during antibiotic stress, understanding its mechanism could inspire novel approaches to bacterial inhibition.

The commercial availability of recombinant ywoB protein facilitates research into its potential applications. As antibiotic resistance continues to emerge as a global health challenge, novel targets and approaches derived from understanding bacterial stress responses, including those involving ywoB, may contribute to addressing this critical issue.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
ywoB; BSU36500; Uncharacterized protein YwoB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywoB
Target Protein Sequence
MMNKGGRLRKAVRKSIPATFRLFLAFNFFVYGLAKVVIGQFGEVTPEIEAAAGKGFTIAW TFFGYSHVYELFIGFGEILAAVLLLIPRTAALGAVIFMPIIVNIVLINYCFDIGVQDLST ILMVMCLILLWMDRRKFMGIFRQEPIDSRQVMKR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis ywoB protein and what are its known characteristics?

The ywoB protein is an uncharacterized protein from Bacillus subtilis with the following characteristics:

  • Official Symbol: YWOB

  • Gene ID: 936938

  • UniProt ID: P94572

  • Also known as: hypothetical protein

The protein remains largely uncharacterized, meaning its specific biological function has not been fully elucidated. As with many hypothetical proteins in B. subtilis, ywoB represents an opportunity for novel functional discoveries. B. subtilis, as a model organism, has been extensively studied and its genome fully sequenced, allowing researchers to investigate uncharacterized proteins within a well-established genetic framework .

What expression systems are most suitable for producing recombinant ywoB protein?

Bacillus subtilis itself serves as an excellent expression system for recombinant ywoB production due to several advantages:

  • GRAS (Generally Recognized As Safe) status, making it suitable for laboratory research

  • Natural ability to absorb and incorporate exogenous DNA into its genome

  • Well-established genetic engineering strategies available

  • Capacity for high-yield protein production

Expression options include:

Expression System TypeAdvantagesConsiderations
Plasmid-based systemsHigh copy number, increased yieldMay require selection markers
Genomic integrationStable expression, no antibiotic neededPotentially lower yield
Constitutive promotersContinuous expressionCannot be regulated
Inducible promotersControlled expression timingRequires inducer
Self-inducing systemsMinimal intervention neededLess precise control

For ywoB specifically, both E. coli and yeast expression systems have been utilized successfully for recombinant production with His-tags .

What are the optimal storage and handling conditions for recombinant ywoB protein?

Based on standard protocols for recombinant B. subtilis proteins including ywoB:

  • Short-term storage: +4°C

  • Long-term storage: -20°C to -80°C

  • Buffer recommendation: PBS buffer

  • Available forms: Liquid or lyophilized powder

For research requiring extended storage, lyophilized preparations typically offer greater stability than liquid formulations. Multiple freeze-thaw cycles should be avoided as they can compromise protein integrity. Aliquoting the protein solution before freezing is recommended to minimize freeze-thaw damage.

What post-translational modifications might be present in ywoB protein and how can they be detected?

Recent proteome-wide studies of B. subtilis have identified numerous post-translational modifications (PTMs) that could potentially be present in ywoB. One significant modification to investigate is lysine 2-hydroxyisobutyrylation (Khib), which has been extensively documented in various organisms .

Methods to detect potential PTMs in ywoB include:

  • Mass spectrometry-based approaches:

    • MaxQuant integrated with Andromeda search engine

    • Settings: 10 ppm mass error for precursor ions, 0.02 Da for fragment ions

    • Variable modifications to search for: oxidation of methionine, 2-hydroxyisobutyrylation on lysine and protein N-terminal

  • Bioinformatic prediction tools:

    • Sequence analysis through UniProt-GOA database

    • InterProScan for functional annotation

    • Analysis of surrounding sequence motifs using MoMo (motif-x algorithm)

A comprehensive PTM analysis would include examination of 2-hydroxyisobutyrylation sites, which are often associated with proteins involved in translation, metabolic processes, and protein biosynthesis pathways.

How can I design experiments to elucidate the function of uncharacterized ywoB?

A multi-faceted approach is recommended:

  • Comparative genomic analysis:

    • Identify potential homologs in related species

    • Search for conserved domains using InterProScan

    • Analyze protein sequence using BLASTP against multiple organisms (H. sapiens, P. patens, O. sativa, S. cerevisiae, T. gondii)

  • Protein interaction studies:

    • Employ STRING database for predicting potential interaction partners

    • Validate interactions using pull-down assays with His-tagged ywoB

    • Visualize networks using Cytoscape

  • Phenotypic analysis through gene knockout/knockdown:

    • Generate ywoB deletion mutants in B. subtilis

    • Compare growth under various stress conditions (temperature, UV, pressure)

    • Assess sporulation efficiency and cellular morphology

  • Laboratory evolution experiments:

    • Subject B. subtilis strains to selective pressures

    • Compare wild-type and mutant adaptations

    • Analyze evolved strains by whole genome sequencing

The combination of these approaches provides complementary data to triangulate the potential function of ywoB from multiple perspectives.

What challenges might arise when working with an uncharacterized protein like ywoB?

Key challenges include:

  • Functional prediction limitations:

    • Absence of known homologs with characterized functions

    • Difficulty in designing activity assays without functional hypotheses

    • Potential for novel or multifunctional roles not predicted by bioinformatics

  • Expression and solubility issues:

    • Optimal expression conditions may require extensive optimization

    • Potential toxicity when overexpressed

    • Protein folding problems in heterologous expression systems

    • Aggregation or inclusion body formation

  • Experimental design complications:

    • Absence of positive controls for functional assays

    • Difficulty distinguishing direct from indirect effects in knockout studies

    • Potential functional redundancy masking phenotypes

Solutions include employing multiple parallel approaches, conducting careful controls, and utilizing the well-developed genetic tools available for B. subtilis to systematically address these challenges.

What are the recommended protocols for purifying His-tagged ywoB protein?

For His-tagged ywoB purification:

  • Expression considerations:

    • Express in E. coli or yeast systems as documented

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Monitor expression using SDS-PAGE

  • Purification protocol:

    • Cell lysis: Sonication or mechanical disruption in PBS buffer with protease inhibitors

    • Clarification: Centrifugation at 10,000-15,000 g for 30 minutes

    • IMAC purification: Ni-NTA or cobalt-based affinity chromatography

    • Washing: Increasing imidazole gradient to remove non-specific binding

    • Elution: Higher imidazole concentration (250-500 mM)

    • Buffer exchange: Dialysis against PBS or gel filtration

  • Quality control:

    • SDS-PAGE to confirm purity (>80% as specified in product data)

    • Western blot using anti-His antibodies

    • Endotoxin testing (<1.0 EU per μg as determined by LAL method)

What proteomics approaches are most suitable for functional characterization of ywoB?

Based on recent advances in proteomics for uncharacterized proteins:

  • Mass spectrometry-based techniques:

    • Bottom-up proteomics for peptide-level identification

    • Top-down proteomics for intact protein analysis

    • Cross-linking mass spectrometry (XL-MS) for structural information

    • Hydrogen-deuterium exchange (HDX) for conformational dynamics

  • PTM analysis workflow:

    • Enrichment strategies for specific modifications

    • Database search parameters: 10 ppm mass error (precursor), 0.02 Da (fragment)

    • FDR threshold: 1% for modification sites

    • Site localization probability threshold: 0.75

  • Protein-protein interaction studies:

    • Affinity purification-mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID)

    • Network analysis using STRING database visualization in Cytoscape

  • Functional enrichment analysis:

    • GO enrichment (biological processes, molecular functions, cellular components)

    • KEGG pathway analysis

    • Protein domain enrichment analysis using InterProScan

These approaches can provide insights into potential cellular pathways, molecular functions, and biological processes associated with ywoB.

How can laboratory evolution experiments be designed to understand ywoB function?

Laboratory evolution provides a powerful approach for understanding protein function in B. subtilis:

  • Experimental design considerations:

    • Compare wild-type and ywoB knockout strains

    • Subject bacteria to relevant environmental stressors:

      • Low atmospheric pressure

      • High ultraviolet radiation

      • Unfavorable growth temperatures

      • Sporulation-inducing conditions

  • Selection regime options:

    • Continuous culture with gradual increase in stress intensity

    • Serial transfer with selective conditions

    • Alternating selection pressures

  • Analysis of evolved strains:

    • Whole genome sequencing to identify compensatory mutations

    • Transcriptomics to identify altered gene expression

    • Proteomics to detect changes in protein abundance

    • Phenotypic characterization of adapted strains

Selection ConditionDurationTransfer MethodAnalysis Methods
Temperature stress500-1000 generationsSerial dilutionWGS, RNA-seq, Proteomics
UV radiation300-500 generationsPlatingDNA damage assessment, WGS
Low pressure500 generationsSpecialized chamberMembrane integrity, Stress response
Sporulation cycling100 cyclesSpore purificationSporulation efficiency, Germination rate
  • Validation approaches:

    • Genetic reconstruction of observed mutations

    • Complementation studies with wild-type ywoB

    • Comparative phenotypic analysis

How should I interpret bioinformatic predictions for ywoB function?

When interpreting bioinformatic predictions:

  • Sequence-based analysis:

    • Evaluate confidence scores for domain predictions

    • Consider evolutionary conservation as a measure of functional importance

    • Examine conservation patterns across phylogenetically diverse organisms

  • Structural predictions:

    • Use secondary structure analysis (α-helix, β-strand, coil) via NetSurfP

    • Consider multiple prediction algorithms to build consensus

    • Validate key structural features experimentally

  • Functional annotation:

    • Gene Ontology enrichment analysis using UniProt-GOA and InterProScan

    • KEGG pathway analysis to identify potential metabolic roles

    • Protein domain enrichment to detect functional modules

  • Integration of multiple lines of evidence:

    • Weigh experimental data more heavily than predictions

    • Consider predictions as hypotheses to be tested

    • Look for convergent evidence from multiple prediction methods

When interpreting contradictory results, examine the underlying assumptions and limitations of each prediction method and prioritize those with experimental validation in similar proteins.

What approaches can resolve contradictory experimental results regarding ywoB function?

When faced with contradictory results:

  • Systematic troubleshooting:

    • Validate reagents (antibody specificity, recombinant protein quality)

    • Confirm genetic constructs through sequencing

    • Test multiple independent clones or isolates

  • Reconciliation strategies:

    • Consider context-dependent functions (growth phase, media conditions)

    • Investigate potential moonlighting functions (multiple biological roles)

    • Examine strain-specific genetic backgrounds

  • Independent validation approaches:

    • Use orthogonal experimental techniques

    • Collaborate with other laboratories for external verification

    • Apply both gain-of-function and loss-of-function approaches

  • Statistical considerations:

    • Increase biological replicates

    • Apply appropriate statistical tests for the data type

    • Consider effect sizes rather than just statistical significance

Contradictions in functional data often reflect the complexity of biological systems and may indicate condition-specific roles or multifunctional properties of ywoB.

How can I determine if phenotypic changes in ywoB mutants are direct or indirect effects?

Distinguishing direct from indirect effects requires:

  • Complementation studies:

    • Reintroduce wild-type ywoB into knockout strains

    • Use inducible expression systems to control timing and level

    • Include proper controls (empty vector, inactive mutant versions)

  • Biochemical validation:

    • In vitro reconstitution of proposed molecular activities

    • Direct binding assays with proposed interaction partners

    • Structure-function analysis using point mutations in key domains

  • Temporal analysis:

    • Time-course experiments to establish order of events

    • Inducible/repressible systems to control ywoB expression

    • Pulse-chase experiments to track dynamic processes

  • Multi-omic integration:

    • Correlate phenotypic, transcriptomic, and proteomic changes

    • Look for enrichment in specific pathways or cellular processes

    • Apply network analysis to identify direct nodes connected to ywoB

These approaches collectively can help establish causality and distinguish direct effects of ywoB from secondary consequences of its disruption.

What are promising research avenues for further characterizing ywoB?

Emerging approaches with potential for ywoB characterization include:

  • CRISPR-based technologies:

    • CRISPRi for tunable gene repression

    • CRISPRa for upregulation studies

    • Base editing for precision mutagenesis without double-strand breaks

  • Structural biology approaches:

    • Cryo-EM for structural determination

    • AlphaFold2 predictions validated by experimental methods

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Single-cell analyses:

    • Single-cell RNA-seq to detect cell-to-cell variation in expression

    • Time-lapse microscopy with fluorescent reporters

    • Microfluidic approaches for phenotypic heterogeneity

  • Systems biology integration:

    • Multi-omic data integration across conditions

    • Mathematical modeling of potential regulatory networks

    • Evolutionary analysis across Bacillus species

These approaches can provide comprehensive insights into ywoB function within the broader context of B. subtilis biology and potentially reveal novel aspects of bacterial physiology.

How might findings from ywoB research translate to applications in biotechnology?

Understanding ywoB function could lead to several applications:

  • Expression system optimization:

    • If involved in protein folding or secretion, may improve recombinant protein yields

    • Potential use as a fusion partner for difficult-to-express proteins

    • Development of novel inducible systems if regulatory functions are discovered

  • Synthetic biology applications:

    • Component in engineered genetic circuits if regulatory role established

    • Potential biosensor development if binding properties characterized

    • Chassis optimization for B. subtilis as a production platform

  • Evolutionary insights:

    • Understanding adaptability of B. subtilis to extreme conditions

    • Potential applications in designing stress-resistant strains

    • Insights into evolution of protein function

  • Bioinformatic tool development:

    • Improved algorithms for function prediction of hypothetical proteins

    • Better understanding of post-translational modification networks

    • Enhanced methods for protein-protein interaction prediction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.