Recombinant Bacillus subtilis Uncharacterized protein ywrE (ywrE)

What is the ywrE protein from Bacillus subtilis and what is known about its sequence?

YwrE (UniProt ID: O05219) is an uncharacterized protein from Bacillus subtilis consisting of 111 amino acids. The full protein sequence is: MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFFPVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL . The protein appears to have multiple transmembrane regions based on its hydrophobic residue distribution, suggesting it may be a membrane-associated protein. Despite having a known sequence, the specific function of ywrE within B. subtilis remains uncharacterized, making it a target for further research in bacterial protein function studies.

What expression systems are most effective for recombinant ywrE production?

E. coli expression systems are predominantly used for recombinant ywrE production. The most common approach involves expressing the full-length protein (residues 1-111) with an N-terminal His-tag in E. coli . This approach leverages the high expression yields and established protocols of E. coli while allowing for efficient purification via nickel-affinity chromatography. The His-tagged construct enables protein detection and purification without disrupting the native protein structure. While yeast expression systems have also been noted as potential alternatives , E. coli remains the primary choice due to its simplicity, cost-effectiveness, and high yield for ywrE expression.

What purification and quality control methods are recommended for recombinant ywrE?

Purification of recombinant His-tagged ywrE typically employs a multi-step approach:

• Initial capture: Nickel-affinity chromatography using the N-terminal His-tag

• Purity assessment: SDS-PAGE analysis (target purity >90%)

• Buffer optimization: Final protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Quality control metrics should include:

• Purity confirmation via SDS-PAGE (>90% purity is considered acceptable)

• Western blot verification using anti-His antibodies

• Mass spectrometry validation of intact protein mass

• Functional assays (if applicable, though challenging for uncharacterized proteins)

The purified protein should be aliquoted to avoid repeated freeze-thaw cycles that can compromise protein integrity .

What are the optimal storage and reconstitution conditions for recombinant ywrE?

For long-term storage, recombinant ywrE should be maintained as follows:

• Long-term storage: Store lyophilized powder at -20°C to -80°C

• Reconstitution: Briefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

• Stabilization: Add glycerol to 5-50% final concentration (50% is recommended) for cryoprotection

• Working storage: For short-term use, store working aliquots at 4°C for up to one week

• Freeze-thaw avoidance: Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided by preparing appropriately sized aliquots

These storage conditions maintain protein stability while minimizing degradation, aggregation, and activity loss common with membrane-associated proteins.

How can researchers validate successful expression of recombinant ywrE?

Validation of recombinant ywrE expression should include multiple complementary approaches:

• SDS-PAGE analysis: To confirm the expected molecular weight (~12.5 kDa plus tag size)

• Western blotting: Using anti-His antibodies to detect the N-terminal tag

• Mass spectrometry: To confirm:

  • Intact protein mass

  • Peptide mapping following proteolytic digestion

  • Sequence coverage and verification

Researchers should note that membrane-associated proteins like ywrE may display aberrant migration patterns on SDS-PAGE due to their hydrophobic nature. Additionally, expression validation is crucial given the uncharacterized nature of ywrE, as functional assays cannot yet be reliably employed to confirm biological activity.

How can genetic code expansion techniques be applied to study ywrE structure and function?

Genetic code expansion provides powerful approaches for studying ywrE's structure and function by incorporating non-standard amino acids (nsAAs) at specific positions. Recent advances in B. subtilis genetic code expansion make this approach particularly relevant .

Methodology for ywrE investigation using genetic code expansion:

• System establishment: Integrate aminoacyl-tRNA synthetase (AARS) and tRNA pairs into the B. subtilis genome. Three effective systems include:

  • MjTyrRS variants for tyrosine-based nsAAs

  • ScWRS (S. cerevisiae tryptophan synthetase) for tryptophan-based nsAAs

  • MaPylRS (M. alvus pyrrolysine synthetase) for pyrrolysine-based nsAAs

• Strategic nsAA incorporation: Introduce UAG codons at positions of interest in the ywrE gene, particularly:

  • Predicted transmembrane boundaries

  • Potential functional domains

  • Suspected protein-protein interaction interfaces

• Functional nsAAs for ywrE characterization:

  • Photo-crosslinking nsAAs (e.g., p-benzoyl-L-phenylalanine) to capture transient protein interactions

  • Click chemistry handles (e.g., p-azido-L-phenylalanine) for selective labeling

  • Fluorescent nsAAs for localization studies

The integration of these techniques can provide insights into ywrE membrane topology, potential binding partners, and subcellular localization, addressing fundamental questions about this uncharacterized protein.

What approaches are effective for investigating potential protein-protein interactions involving ywrE?

Given ywrE's uncharacterized nature, investigating its protein-protein interactions is essential for functional characterization. Several complementary approaches are recommended:

• Photo-crosslinking with genetically encoded nsAAs:

  • Incorporate photo-crosslinking nsAAs like p-benzoyl-L-phenylalanine at predicted interaction interfaces

  • Perform UV-induced crosslinking (15-minute exposure shown to be sufficient in B. subtilis)

  • Analyze crosslinked products by Western blotting and mass spectrometry

• Co-immunoprecipitation strategies:

  • Express epitope-tagged ywrE in B. subtilis

  • Perform membrane-specific solubilization using mild detergents

  • Immunoprecipitate complexes and identify partners by mass spectrometry

• Bacterial two-hybrid screening:

  • Adapt existing bacterial two-hybrid systems for membrane protein analysis

  • Screen against B. subtilis genomic libraries to identify potential interactors

• Proximity-based labeling:

  • Fuse ywrE to enzymes like BioID or APEX2

  • Identify proteins in spatial proximity through biotinylation and subsequent pulldown

The YukE protein system described in the literature provides a relevant methodological model, demonstrating that photo-crosslinking can efficiently validate predicted protein interfaces in B. subtilis .

How can researchers assess ywrE localization and membrane topology in living B. subtilis cells?

Understanding ywrE's subcellular localization and membrane topology is crucial for functional characterization. Several complementary approaches are recommended:

• Fluorescent protein fusions with topological consideration:

  • C-terminal vs. N-terminal fusions to determine orientation

  • Split-GFP complementation to verify membrane topology

  • Super-resolution microscopy for precise localization

• nsAA-based strategies:

  • Incorporate click chemistry-compatible nsAAs at specific positions

  • Perform selective labeling with membrane-permeable or impermeable dyes

  • Analyze accessibility to determine topology

• Cysteine accessibility method:

  • Introduce cysteine residues at strategic positions

  • Treat with membrane-permeable and impermeable sulfhydryl reagents

  • Determine accessibility to infer topology

• Protease protection assays:

  • Prepare spheroplasts or membrane fractions

  • Perform limited proteolysis with and without membrane permeabilization

  • Analyze protected fragments by Western blotting and mass spectrometry

These approaches provide complementary information about ywrE's orientation within the membrane and its distribution in B. subtilis cells, critical for understanding its potential function.

What experimental approaches can reveal potential functions of the uncharacterized ywrE protein?

Revealing the function of ywrE requires a multi-faceted approach combining genetic, biochemical, and computational methods:

• Comparative genomics analysis:

  • Identify conserved domains and potential orthologs in related species

  • Analyze genomic context to identify functionally related genes

  • Examine co-evolution patterns with known functional partners

• CRISPR-based genetic studies:

  • Generate ywrE deletion and depletion strains

  • Perform phenotypic characterization under various conditions

  • Conduct genetic suppressor screens to identify functionally related genes

• Stress response profiling:

  • Challenge B. subtilis with environmental stressors (pH, temperature, osmotic stress)

  • Compare wild-type and ywrE-mutant responses

  • Quantify survival rates and adaptive responses

• Laboratory evolution experiments:

  • Subject B. subtilis to conditions that might reveal ywrE function

  • Sequence evolved strains to identify compensatory mutations

  • Perform transcriptomics to identify co-regulated genes

This integrated approach leverages the experimental tractability of B. subtilis to systematically probe ywrE function, potentially revealing its role in adaptation, stress response, or other cellular processes.

How can structural biology techniques be optimized for studying membrane-associated proteins like ywrE?

Membrane proteins like ywrE present unique challenges for structural characterization. Optimized approaches include:

• Protein engineering for structural studies:

  • Design truncated constructs to remove flexible regions

  • Introduce mutations to improve stability without altering function

  • Create fusion proteins with crystallization chaperones

• Detergent screening and optimization:

  • Systematic testing of detergent types for extraction efficiency

  • Detergent exchange protocols for improved stability

  • Bicelle and nanodisc reconstitution for near-native environment

• Cryo-EM sample preparation:

  • Optimize grid preparation with various support films

  • Test different detergent concentrations to minimize background

  • Consider antibody fragments to increase particle size

• Hybrid approach utilizing complementary techniques:

  • Computational structure prediction (AlphaFold2) as starting model

  • Cross-validation with low-resolution experimental data

  • Targeted incorporation of distance constraints from crosslinking

These strategies can overcome the inherent challenges in membrane protein structural biology, potentially yielding insights into ywrE's structure-function relationship despite its small size (111 amino acids).

What controls should be included when studying recombinant ywrE in heterologous expression systems?

Rigorous controls are essential when working with uncharacterized proteins like ywrE in heterologous systems:

• Expression controls:

  • Empty vector control to assess background expression

  • Well-characterized control protein (similar size/hydrophobicity)

  • Wild-type vs. tagged protein comparison to assess tag effects

• Localization controls:

  • Known membrane protein control with established topology

  • Cytoplasmic protein control to validate fractionation

  • Orthogonal localization verification (e.g., immunofluorescence vs. fractionation)

• Interaction controls:

  • Non-specific binding controls using scrambled sequence or irrelevant protein

  • Competition assays with unlabeled protein to verify specificity

  • Negative control nsAA positions (e.g., non-interface residues for photo-crosslinking)

• Functional assays:

  • Complementation controls using wild-type B. subtilis

  • Dose-response relationships to establish specificity

  • Parallel assays in both native B. subtilis and heterologous systems

How can researchers address the challenges of working with small, hydrophobic bacterial proteins like ywrE?

Working with small, hydrophobic proteins like ywrE (111 amino acids) presents specific technical challenges that require dedicated strategies:

• Optimized solubilization protocols:

  • Systematic screening of detergent types and concentrations

  • Two-phase extraction systems for improved recovery

  • Evaluation of protein quality by size-exclusion chromatography

• Expression optimization:

  • Low-temperature induction to improve folding

  • Co-expression with chaperones to enhance solubility

  • Fusion partners that enhance expression without interfering with function

• Analytical considerations:

  • Modified SDS-PAGE conditions for small hydrophobic proteins

  • Alternative mass spectrometry approaches for membrane proteins

  • Circular dichroism protocols optimized for detergent-solubilized samples

• Stability enhancement:

  • Buffer optimization with stabilizing additives (e.g., trehalose)

  • Strategic mutation of aggregation-prone residues

  • Design of minimal functional constructs

These approaches directly address the physicochemical properties of ywrE that complicate its study, enabling more reliable biochemical and structural characterization of this challenging protein class.

How should researchers interpret phenotypic changes in ywrE mutant strains given its uncharacterized function?

Interpreting phenotypic changes in ywrE mutant strains requires careful analysis to distinguish primary effects from compensatory responses:

• Comprehensive phenotypic profiling:

  • Monitor growth parameters under diverse conditions

  • Examine morphological changes across growth phases

  • Assess specific cellular processes (sporulation, stress response)

• Multi-omics integration approach:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Identify pathways consistently altered across multiple datasets

  • Map changes to known B. subtilis regulatory networks

• Temporal analysis of phenotypic development:

  • Track phenotypic changes over time rather than endpoint measurements

  • Distinguish immediate from adaptive responses

  • Identify phenotypic reversibility upon complementation

• Genetic interaction mapping:

  • Construct double mutants with genes in suspected pathways

  • Identify synthetic lethal or suppressor interactions

  • Use laboratory evolution to identify compensatory mutations

This systematic approach helps distinguish the primary function of ywrE from secondary effects, generating testable hypotheses about its biological role despite its uncharacterized status.

What bioinformatic approaches are most valuable for predicting potential functions of ywrE?

Given ywrE's uncharacterized status, computational approaches provide critical insights for experimental design:

• Advanced sequence analysis:

  • Remote homology detection using profile-HMM methods

  • Identification of conserved sequence motifs across bacterial species

  • Analysis of amino acid conservation patterns within predicted functional regions

• Structural prediction integration:

  • AlphaFold2 or RoseTTAFold structure prediction

  • Structure-based function prediction using platforms like COFACTOR

  • Identification of potential binding pockets or catalytic sites

• Genomic context analysis:

  • Examination of conserved gene neighborhoods across Bacillus species

  • Identification of potential operonic relationships

  • Detection of co-occurrence patterns with functionally characterized genes

• Network-based approaches:

  • Construction of co-expression networks from public B. subtilis datasets

  • Guilt-by-association analysis with functionally annotated genes

  • Integration with protein-protein interaction data

These computational approaches provide testable hypotheses about ywrE function, guiding experimental design and interpretation of results from the methodologies described earlier.

How can CRISPR-based methods be applied to study the native function of ywrE in B. subtilis?

CRISPR-based techniques offer powerful approaches for investigating ywrE function in its native context:

• CRISPRi for conditional depletion:

  • Design sgRNAs targeting the ywrE gene or promoter region

  • Establish titratable repression with inducible dCas9 systems

  • Monitor phenotypic consequences across growth conditions

• CRISPR-based precise genome editing:

  • Generate clean deletions, point mutations, or tagged variants

  • Introduce mutations in potential functional residues

  • Create reporter fusions at the native locus

• CRISPR scanning mutagenesis:

  • Systematically target regions throughout the ywrE gene

  • Identify domains critical for function

  • Map the relationship between sequence and phenotype

• CRISPRa for overexpression studies:

  • Upregulate ywrE expression from its native context

  • Assess dose-dependent phenotypes

  • Identify potential negative regulatory mechanisms

These CRISPR approaches offer significant advantages over traditional genetic methods in B. subtilis, including precision, efficiency, and the ability to create graded phenotypes through titratable systems.

How can non-standard amino acid incorporation advance understanding of ywrE function and interactions?

The incorporation of non-standard amino acids (nsAAs) provides unique capabilities for studying ywrE:

• Site-specific biophysical probes:

  • Incorporate environmentally sensitive fluorescent nsAAs

  • Monitor conformational changes in response to stimuli

  • Detect local environmental changes within the membrane

• Photo-crosslinking applications:

  • Map protein-protein interaction interfaces with single-residue precision

  • Capture transient or weak interactions in vivo

  • Identify interaction partners without overexpression artifacts

• Click chemistry for proteomic studies:

  • Incorporate bioorthogonal handles (azides, alkynes)

  • Perform selective labeling for visualization or enrichment

  • Enable pulse-chase experiments to study protein dynamics

• Translational titration for dosage studies:

  • Utilize the efficiency of nsAA incorporation to modulate protein levels

  • Create a graded series of expression levels

  • Study dosage-dependent phenotypes without changing transcription

The recent demonstration of efficient genetic code expansion in B. subtilis makes these approaches particularly valuable for studying challenging membrane proteins like ywrE in their native cellular context .