Recombinant Bacillus subtilis Uncharacterized protein yxaC (yxaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type selection occurs during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yxaC; BSU40020; S14CR; Uncharacterized protein YxaC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxaC
Target Protein Sequence
MQQACIAIIIILLTVAAYLAMVKLYKRFPLPFLIPVLTTTILIVAALMMFHVSYEGYMIG GKWINSLLGPAVVALAYPLYKQWHIIVKHCVPILGGVLVGLCMGMISGLIFAEAFGIDHD LLLSILPKSITTPVAIQIAAGLGGVPSMTVVFVMIAGFSGVILGPLFLKWLRIRSSLGQG IALGSASHALGTSKALEYGELAVSMSSVSMTLCAVLGSFFGPLVVWLFHI
Uniprot No.

Target Background

Database Links
Protein Families
YohK (E.coli)/YwbG (IPA-22R) (B.subtilis) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the current state of knowledge regarding yxaC protein in B. subtilis?

The yxaC protein remains largely uncharacterized in Bacillus subtilis. It is classified as a hypothetical protein with unknown function in the B. subtilis genome. Current research approaches focus on expression, purification, and preliminary characterization to determine its biological role. While commercial sources provide recombinant versions of this protein (such as the partial protein preparation available from suppliers), fundamental research into its structure and function remains limited . Researchers should consider that working with uncharacterized proteins requires a systematic approach to functional annotation, beginning with sequence analysis and conserved domain prediction before experimental characterization.

Why is B. subtilis preferred as an expression system for studying proteins like yxaC?

B. subtilis offers several significant advantages as an expression host for studying its native proteins:

  • GRAS (Generally Recognized As Safe) status enabling safer laboratory handling

  • Natural capacity to absorb and incorporate exogenous DNA into its genome

  • Well-developed genetic tools resulting from decades of study regarding its biology

  • Capacity for high-yield protein production, particularly for secreted proteins

  • Complete genome sequencing and annotation enabling comprehensive genetic manipulation

  • Availability of engineered strains with reduced protease activity (e.g., WB600, WB800)

When studying an uncharacterized native protein like yxaC, using B. subtilis as the expression host provides the natural cellular environment, potentially preserving proper folding, post-translational modifications, and interaction partners that might be essential for understanding its true biological function.

What expression vector systems are recommended for studying yxaC in B. subtilis?

The following expression systems are particularly suitable for expressing uncharacterized proteins like yxaC in B. subtilis:

Expression SystemInducerAdvantagesConsiderations
pHT43 vectorIPTGStrong promoter derived from B. subtilis groE operon; yields of 15-20 mg/L for nanobody proteinsGood for cytoplasmic expression; comparable yields to E. coli systems
P grac212IPTGRobust expression; achieves 11-16% of total cellular proteinsEffective for cytoplasmic expression with high specific activity
BlaI cassette system-Marker-free chromosomal integration; allows multiple genetic manipulationsEnables study of protein in native genomic context

For yxaC specifically, expression in its native host using either inducible systems (for controlled expression levels) or integration at the native locus (for studying physiological function) would be recommended based on your specific research goals.

How should I approach the initial characterization of the uncharacterized yxaC protein?

A methodical approach to initial characterization involves:

  • Bioinformatic analysis:

    • Sequence alignment with homologous proteins across species

    • Prediction of conserved domains and potential functional motifs

    • Structure prediction using tools like AlphaFold

  • Expression optimization:

    • Test multiple promoter systems (constitutive vs. inducible)

    • Evaluate both cytoplasmic expression and secretion approaches

    • Compare expression levels using different signal peptides if pursuing secretion

  • Functional screening:

    • Growth phenotype assessment of knockout mutants

    • Protein localization studies using fluorescent tags

    • Preliminary enzymatic activity assays based on predicted domains

Document all experimental conditions carefully, as the process of characterizing unknown proteins often requires iterative optimization based on preliminary findings.

What secretion pathways should be considered for expressing and studying yxaC protein?

When investigating the potential secretory nature of yxaC, researchers should consider the two main secretion pathways in B. subtilis:

  • Sec-dependent transport system:

    • The primary secretion pathway in B. subtilis

    • Utilizes ATP and transmembrane proton gradients as energy sources

    • Requires proteins in unfolded state during translocation

    • Appropriate for most exported proteins in B. subtilis

  • Twin-arginine (Tat) translocation system:

    • Specializes in transporting folded proteins

    • Less commonly used but important for certain protein classes

    • May be preferred if yxaC requires folding before secretion

To determine the optimal pathway:

  • Analyze the native yxaC sequence for signal peptides

  • Test expression constructs with different signal sequences targeting each pathway

  • Compare yield, activity, and proper folding of the resulting protein

It's crucial to monitor the quality control system in B. subtilis, which includes intracellular and extracytoplasmic chaperones, cell wall proteases, and extracellular proteases that may affect the secretion and stability of yxaC .

What inducer-dependent promoter systems would optimize expression of yxaC for functional studies?

Several inducer-dependent promoter systems have been developed for B. subtilis that offer precise control over expression timing and levels:

Promoter SystemInducerCharacteristicsApplication to yxaC
spac promoterIPTGClassic inducible system combining SPO-1 phage promoter with lac operatorGood starting point for controlled expression
groE-derived promoterIPTGStrong expression (15-20 mg/L yields for nanobodies)Suitable when high protein quantities are needed
Amber suppression systemIPTGAllows incorporation of non-canonical amino acidsUseful for specialized studies requiring chemical decoration of yxaC
Carbohydrate-inducible promotersSucrose, mannose, xylose, maltoseMore economical than IPTG; variable expression strengthsCost-effective for large-scale expression studies

When studying uncharacterized proteins like yxaC, it's often beneficial to test multiple promoter systems, as protein toxicity, folding requirements, and expression kinetics can vary significantly. For yxaC specifically, beginning with the well-characterized IPTG-inducible systems provides a reliable starting point, with optimization based on initial results.

How can I design knockout and complementation studies to elucidate yxaC function?

A comprehensive functional analysis approach would include:

  • Generation of marker-free knockout strains:

    • Utilize the BlaI cassette method for clean gene deletion

    • This technique allows:

      • Introduction of the BlaI cassette into the chromosome by homologous recombination

      • Positive selection using spectinomycin resistance

      • Subsequent eviction of the cassette via single crossover between direct repeat sequences

      • Creation of markerless deletions, enabling multiple genetic manipulations in the same strain

  • Phenotypic analysis:

    • Compare growth characteristics under various conditions

    • Assess morphological changes using microscopy

    • Evaluate stress responses and metabolic parameters

    • Analyze global gene expression changes using transcriptomics

  • Complementation studies:

    • Reintroduce wild-type yxaC at different expression levels

    • Test point mutants targeting predicted functional residues

    • Use controlled expression systems to evaluate dosage effects

  • Construct chimeric proteins:

    • Create reporter fusions for localization studies

    • Develop affinity-tagged versions for interaction studies

    • Design domain swap constructs with related proteins

This approach enables a systematic investigation of yxaC function while maintaining the genetic integrity of the model system.

What proteomic approaches would be most effective for identifying yxaC interaction partners?

Elucidating protein-protein interactions is crucial for understanding the function of uncharacterized proteins like yxaC. Several complementary approaches should be considered:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express yxaC with affinity tags (His, FLAG, etc.)

    • Optimize tag position (N- or C-terminal) to minimize functional interference

    • Perform crosslinking prior to lysis to capture transient interactions

    • Identify co-purifying proteins using mass spectrometry

    • Include appropriate controls (untagged strains, irrelevant tagged proteins)

  • Bacterial two-hybrid screening:

    • Screen yxaC against a library of B. subtilis proteins

    • Validate positive interactions using independent methods

    • Consider both cytoplasmic and membrane-based two-hybrid systems depending on predicted localization

  • Proximity-dependent labeling:

    • Fuse yxaC to enzymes like BioID or APEX2

    • Identify proteins in close proximity in vivo

    • Particularly valuable for identifying weak or transient interactions

  • Co-immunoprecipitation with targeted candidates:

    • Based on bioinformatic predictions and preliminary data

    • Test specific hypotheses about functional relationships

Each method has distinct advantages and limitations; therefore, using multiple complementary approaches provides the most comprehensive understanding of the yxaC interactome.

How can I overcome protein degradation challenges when expressing yxaC in B. subtilis?

Proteolytic degradation is a common challenge when expressing recombinant proteins in B. subtilis. For uncharacterized proteins like yxaC, several strategies can mitigate this issue:

  • Engineered host strains:

    • Utilize protease-deficient strains like WB600 (six proteases deleted) or WB800 (eight proteases deleted)

    • These strains significantly reduce proteolytic degradation of secreted target proteins

  • Expression optimization:

    • Adjust induction conditions (temperature, inducer concentration, timing)

    • Test different growth media compositions

    • Optimize harvest timing to capture maximum intact protein

  • Protein engineering approaches:

    • Identify and modify protease-sensitive sites

    • Add stabilizing fusion partners

    • Incorporate protein design principles to enhance thermodynamic stability

  • Process optimization:

    • Add protease inhibitors during extraction and purification

    • Maintain cold temperatures throughout processing

    • Minimize sample handling time

A systematic approach comparing different combinations of these strategies should be employed to determine the optimal conditions for yxaC expression and purification.

What structural biology techniques are most appropriate for determining the structure of yxaC?

Understanding the structure of uncharacterized proteins provides crucial insights into their function. For yxaC, a multi-technique approach is recommended:

  • X-ray crystallography:

    • Requires high-purity, homogeneous protein samples

    • Optimize expression and purification to obtain milligram quantities

    • Perform crystallization screening with various precipitants and conditions

    • Consider surface entropy reduction mutations if crystallization proves difficult

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable if yxaC forms larger complexes

    • Less dependent on crystallization but requires stable, homogeneous samples

    • Can provide insights into different conformational states

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Suitable for smaller domains of yxaC

    • Enables study of protein dynamics in solution

    • Requires isotopic labeling (15N, 13C) of the protein

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution structural information in solution

    • Useful for validating computational models and determining oligomeric states

    • Less demanding in terms of sample quantity and purity

  • Integrative structural biology:

    • Combine experimental data with computational approaches

    • Incorporate homology modeling, molecular dynamics simulations

    • Validate with biochemical and biophysical techniques

The optimal approach will depend on the properties of yxaC, including its size, stability, and tendency to form complexes.

How should I design experiments to determine if yxaC has enzymatic activity?

When investigating potential enzymatic activities of uncharacterized proteins like yxaC, a systematic approach combining bioinformatics and biochemical screening is recommended:

  • Bioinformatic prediction of potential activities:

    • Sequence analysis for recognized catalytic motifs

    • Structural comparison with characterized enzymes

    • Genomic context analysis (neighboring genes and operons)

  • Activity screening design:

    • Prepare recombinant yxaC under various conditions (different tags, expression systems)

    • Test substrate panels based on predicted activities and genomic context

    • Employ both targeted assays and broader metabolite profiling

  • Assay optimization considerations:

    • Buffer composition (pH, salt concentration, potential cofactors)

    • Incubation conditions (temperature, time)

    • Detection methods (spectrophotometric, fluorometric, HPLC, mass spectrometry)

  • Controls and validation:

    • Include negative controls (heat-inactivated protein, catalytic site mutants)

    • Positive controls (known enzymes with similar predicted activities)

    • Determine enzyme kinetic parameters if activity is identified

This methodical approach maximizes the chances of detecting enzymatic activity while minimizing false positives and artifacts.

What strategies can be employed for resolving contradictory data regarding yxaC function?

Contradictory results are common when studying uncharacterized proteins and require careful investigation:

  • Methodological analysis:

    • Examine differences in experimental conditions between contradictory studies

    • Consider expression systems, tags, buffer conditions, and assay methods

    • Replicate experiments using standardized protocols

  • Strain-specific effects:

    • Test the same experiments in multiple B. subtilis strains

    • Consider genetic background differences that might influence results

    • Examine strain-specific post-translational modifications or interaction partners

  • Context-dependent function:

    • Investigate whether yxaC has different functions under different conditions

    • Test various growth phases, stress conditions, and nutrient limitations

    • Consider potential moonlighting functions

  • Collaboration and validation:

    • Engage multiple laboratories with different expertise

    • Use complementary techniques to address the same question

    • Perform blind studies to eliminate investigator bias

  • Mathematical modeling:

    • Develop models that might explain seemingly contradictory observations

    • Design critical experiments to test competing hypotheses

    • Consider kinetic, thermodynamic, and systems-level explanations

Resolving contradictions often leads to deeper insights into protein function and can reveal complex regulatory mechanisms or condition-specific behaviors.

How can I optimize codon usage for efficient expression of yxaC in heterologous systems?

While expressing yxaC in its native B. subtilis reduces codon optimization concerns, heterologous expression may require optimization:

  • Codon usage analysis:

    • Calculate Codon Adaptation Index (CAI) for the native sequence

    • Identify rare codons that might limit translation efficiency

    • Compare codon frequencies between B. subtilis and the target expression host

  • Optimization strategies:

    • Replace rare codons with more frequent synonymous codons

    • Maintain natural codon distribution patterns rather than maximizing CAI

    • Consider mRNA secondary structure and stability

    • Preserve regulatory elements that might be embedded in the sequence

  • Experimental validation:

    • Compare expression levels between native and optimized sequences

    • Analyze protein folding and activity to ensure optimization doesn't affect function

    • Measure mRNA levels to distinguish between transcriptional and translational effects

When working with yxaC specifically, gradual codon optimization may be preferable to wholesale replacement, as this allows identification of critical sequence elements that might affect expression beyond simple codon usage.

What approaches can determine whether yxaC is essential for B. subtilis survival?

Determining gene essentiality requires careful experimental design:

  • Conditional knockout strategies:

    • Create strains with inducible/repressible yxaC expression

    • Use systems like the BlaI cassette for precise genetic manipulation

    • Monitor growth and viability upon depletion of yxaC expression

  • Transposon mutagenesis:

    • Perform saturating transposon mutagenesis

    • Analyze insertion site distribution using high-throughput sequencing

    • Absence of insertions in yxaC suggests essentiality

  • CRISPR interference approaches:

    • Deploy dCas9-based transcriptional repression

    • Titrate repression levels to identify minimum expression requirements

    • Monitor growth phenotypes across various conditions

  • Complementation testing:

    • Attempt yxaC deletion in the presence of ectopically expressed yxaC

    • Test whether deletion is possible when complemented

    • Identify minimum functional domains through truncation studies

  • Synthetic lethality screening:

    • Identify genetic interactions through systematic double-mutant analysis

    • Map the functional network surrounding yxaC

    • Determine condition-specific essentiality patterns

These approaches provide complementary evidence regarding essentiality and can reveal nuanced functions that might be overlooked by any single method.

What are the most promising future research directions for understanding yxaC function?

Several promising avenues for future research could accelerate understanding of yxaC:

  • Integrative -omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics in yxaC mutants

    • Identify consistent patterns across multiple data types

    • Build comprehensive models of yxaC function within cellular networks

  • Evolutionary analysis:

    • Examine conservation patterns across bacterial species

    • Identify co-evolving proteins that might function with yxaC

    • Study natural variations in diverse B. subtilis strains

  • Single-cell studies:

    • Investigate cell-to-cell variability in yxaC expression

    • Determine whether yxaC functions in subpopulations or specific cell states

    • Analyze temporal dynamics during growth and development

  • Systems biology integration:

    • Incorporate yxaC into genome-scale metabolic models

    • Simulate the effects of yxaC perturbation on cellular homeostasis

    • Generate testable hypotheses about conditional functions

  • Structural biology breakthroughs:

    • Apply emerging structural prediction tools alongside traditional methods

    • Focus on dynamic aspects of protein structure

    • Investigate potential conformational changes upon interaction with binding partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.