Recombinant Bacillus subtilis Uncharacterized protein yxaJ (yxaJ)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

YxaJ is typically produced in E. coli or B. subtilis expression systems. Key parameters for its recombinant production include:

ParameterDetails
Expression SystemE. coli (commonly used) or B. subtilis secretion systems
TagN-terminal 10×His tag (common for affinity purification)
Storage ConditionsTris-based buffer with 50% glycerol; store at –20°C (short-term) or –80°C (long-term)
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

Role in Bacillus subtilis Biology

While YxaJ remains uncharacterized functionally, transcriptional profiling studies indicate that its expression is repressed by Rok, a global transcriptional regulator in B. subtilis. Rok directly binds to the yxaJ promoter, suggesting involvement in pathways related to membrane-localized or secreted proteins .

Applications in Research

YxaJ has been utilized in studies exploring:

  • Protein Secretion Mechanisms: As a model substrate for investigating Sec- or Tat-dependent secretion pathways in B. subtilis .

  • Regulatory Networks: To elucidate Rok-mediated gene regulation and its impact on stress responses .

  • Structural Studies: For analyzing transmembrane protein folding in Gram-positive bacteria .

Challenges and Optimization

Production of YxaJ faces challenges common to recombinant proteins in B. subtilis:

  • Proteolytic Degradation: Addressed using protease-deficient strains (e.g., WB800) .

  • Secretion Efficiency: Optimized via signal peptide screening (e.g., Sec/Tat pathways) .

Future Directions

Further characterization of YxaJ could focus on:

  • Functional Annotation: Structural studies (e.g., cryo-EM) to infer biological roles.

  • Biotechnological Applications: Engineered as a fusion partner for surface display systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yxaJ; BSU39950; S14J; Uncharacterized protein YxaJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxaJ
Target Protein Sequence
MSKKNSVAIMTTISAFLFCAVIVAASLSPLAGTGAAANQFNSAGMWSAVGMILVLYFIPF LVYMLGVDAMRYVMAVLCGFGLLIHLSSAGFILMFSFFSDHLLSEVIFVLGVSLAAAAVN VIWFVAAFRSGAEKTSVNTLT
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of B. subtilis uncharacterized protein yxaJ?

While the specific function of yxaJ remains uncharacterized, computational analysis can provide initial insights. Similar to other B. subtilis proteins that were once uncharacterized (such as YoaJ/EXLX1), functional predictions can be made through sequence homology, domain architecture analysis, and structural modeling approaches . The presence of conserved domains or structural similarities to characterized proteins can suggest potential cellular roles. For uncharacterized proteins like yxaJ, researchers should employ multiple bioinformatic approaches including BLAST analysis, hidden Markov models, and comparative genomics to generate testable hypotheses about function.

What expression systems are most effective for recombinant production of yxaJ protein?

  • Optimize the mRNA secondary structure at the translation initiation site

  • Employ synonymous codon substitutions in the first 9 codons to enhance accessibility

  • Use computational tools like TIsigner to predict and improve expression levels

Expression trials should test multiple conditions as accessibility of translation initiation sites has been shown to be a more reliable predictor of expression success than other features .

What are the key challenges in purifying recombinant yxaJ protein?

Purification of uncharacterized proteins like yxaJ presents several challenges that require methodological considerations:

  • Solubility assessment: Test multiple buffer conditions to identify optimal solubility parameters

  • Tag selection: Compare affinity tags (His6, GST, MBP) for their impact on protein folding and function

  • Removal of endotoxins: Essential for downstream functional assays, particularly if the protein will be used in cellular systems

A systematic approach testing different purification strategies is recommended, as uncharacterized proteins may exhibit unexpected physicochemical properties. Researchers should analyze protein purity using both SDS-PAGE and mass spectrometry techniques to ensure sample integrity.

How can RNA-sequencing data guide functional characterization of yxaJ?

RNA-sequencing provides powerful insights for uncharacterized proteins. When studying yxaJ, consider transcriptomic approaches similar to those used in B. subtilis RNase Y studies, where approximately 25% of all genes showed differential expression in comparative analyses . A methodological approach should include:

  • Comparing wild-type B. subtilis to yxaJ deletion or overexpression strains

  • Analyzing conditions where yxaJ shows significant expression changes

  • Identifying co-regulated genes that may suggest functional associations

RNA homeostasis in B. subtilis involves complex regulatory networks, as demonstrated by RNase Y studies showing interconnections between RNA processing and transcription machinery . When analyzing RNA-seq data for yxaJ characterization, researchers should examine both direct transcriptional effects and potential broader impacts on RNA metabolism pathways.

What approaches can identify potential interaction partners of yxaJ protein?

Identifying protein-protein interactions is crucial for functional characterization of uncharacterized proteins. For yxaJ, consider methods that have proven effective for other B. subtilis proteins:

Interaction Detection MethodAdvantagesLimitationsData Analysis Approach
Bacterial Two-HybridIn vivo detection, scalablePotential false positivesStatistical filtering with appropriate controls
Co-immunoprecipitation with MSDetects native complexesRequires specific antibodiesSAINT algorithm for confidence scoring
Crosslinking MSCaptures transient interactionsComplex data analysisXlinkX or similar specialized software
Proximity-based labeling (BioID)Detects spatial proximityRequires genetic modificationEnrichment analysis against control samples

How can structural biology approaches illuminate yxaJ function?

Structural characterization of uncharacterized proteins has proven highly informative, as demonstrated with the EXLX1 protein (encoded by yoaJ) in B. subtilis . For yxaJ, consider this methodological workflow:

  • Initial structural prediction using AlphaFold or RoseTTAFold

  • Experimental structure determination through X-ray crystallography or cryo-EM

  • Structure-function analysis through identification of potential active sites

  • Comparative structural analysis with known protein families

The crystal structure of EXLX1 revealed a remarkable similarity to plant β-expansins and provided crucial insights into its function despite initially being uncharacterized . Similar breakthroughs could emerge from structural studies of yxaJ, potentially revealing unexpected relationships to known protein families and functional domains.

What genetic manipulation strategies are most effective for studying yxaJ in B. subtilis?

When designing genetic studies for yxaJ characterization, researchers should consider potential compensatory mutations that might arise. Studies with RNase Y have demonstrated that B. subtilis rapidly evolves suppressor mutations when essential or quasi-essential genes are deleted . A comprehensive approach should include:

  • Generation of clean deletion mutants with verification by whole-genome sequencing

  • Construction of conditional expression systems to study essential functions

  • Implementation of CRISPR-Cas9 methods for precise genomic modifications

  • Creation of reporter fusions to monitor expression and localization

Researchers should be vigilant for suppressor mutations that may arise spontaneously, as observed in RNase Y deletion strains where suppressors included duplication of RNA polymerase genes and mutations affecting transcription . These evolutionary adaptations can provide valuable functional insights but must be distinguished from primary phenotypes.

How should researchers design experiments to determine if yxaJ affects RNA metabolism?

Given the importance of RNA processing proteins in B. subtilis, such as RNase Y , researchers investigating potential RNA-related functions of yxaJ should implement:

  • Comparative RNA stability assays between wild-type and yxaJ mutant strains

  • CLIP-seq (Crosslinking and Immunoprecipitation) to identify directly bound RNA targets

  • In vitro RNA binding and processing assays with purified recombinant yxaJ

  • Analysis of global RNA length distributions using RNA-seq and appropriate bioinformatic tools

RNA metabolism is tightly regulated in B. subtilis, with RNase Y deletion affecting approximately 25% of the transcriptome . When assessing potential RNA-related functions of yxaJ, researchers should examine both direct effects on specific transcripts and global impacts on RNA homeostasis.

What experimental controls are critical when assessing phenotypes of yxaJ mutants?

Phenotypic analysis of mutants requires careful experimental design and appropriate controls. For yxaJ studies, researchers should implement:

Control TypePurposeImplementation
ComplementationVerifies phenotype causalityExpression of wild-type yxaJ from a neutral locus
Point mutantsIdentifies critical residuesSystematic alanine scanning of conserved amino acids
Plasmid controlsControls for expression artifactsEmpty vector controls with matched promoters
Growth condition controlsReveals condition-specific phenotypesTesting multiple media and stress conditions
Suppressor analysisIdentifies genetic interactionsWhole-genome sequencing of adapted mutants

The importance of suppressor analysis is highlighted by RNase Y studies where deletion strains rapidly acquired mutations affecting transcription machinery to restore viable phenotypes . Similarly, yxaJ mutants may develop compensatory mutations that can provide insights into functional pathways and genetic interactions.

How can researchers distinguish direct from indirect effects when characterizing yxaJ function?

Distinguishing direct from indirect effects represents a significant challenge in functional characterization. Methodological approaches should include:

  • Time-resolved studies to capture immediate versus delayed responses

  • Catalytically inactive mutants to separate enzymatic from structural roles

  • In vitro reconstitution with purified components to verify direct activities

  • Integration of multiple data types (transcriptomic, proteomic, metabolomic)

Studies of RNase Y in B. subtilis demonstrated how deletion affected approximately 25% of the transcriptome, with both direct targets and downstream regulatory effects . Similar complex networks may be revealed when studying yxaJ, requiring careful experimental design to delineate primary functions from secondary consequences.

What statistical approaches should be used when analyzing high-throughput data for yxaJ characterization?

High-throughput data analysis for uncharacterized proteins requires robust statistical frameworks:

  • Implement appropriate multiple testing corrections (Benjamini-Hochberg procedure)

  • Use effect size measurements alongside p-values (fold change, Cohen's d)

  • Perform sensitivity analyses with varying normalization methods

  • Apply pathway enrichment tools with appropriate background models

When analyzing RNA-seq data, consider approaches used in RNase Y studies where gene expression changes were interpreted in the context of regulons and biological pathways . For yxaJ, similar contextual analysis may reveal functional associations even before direct biochemical characterization is complete.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.