Recombinant Bacillus subtilis Uncharacterized protein yxeC (yxeC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yxeC; BSU39600; HS74C; Uncharacterized protein YxeC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxeC
Target Protein Sequence
MGITKRGAAWEWLHSWWMLFIFMPFAITSFFAFLFIGIKVRNRKWIMYGIIYFFIFAFGF VLPDLPGVFIVVPLWAVTIIHGFKVRPLYLIQLDVYKDHVEARAFAEARSEAESRFHAPK QSIQDIHIRKEQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the Bacillus subtilis YxeC protein?

YxeC is a hypothetical protein from Bacillus subtilis subsp. subtilis str. 168. It is currently classified as uncharacterized, with limited information about its specific biological function. The protein is identified in genomic databases with Gene ID 937578 and UniProt ID P54942 . While its precise role remains undetermined, studying uncharacterized proteins like YxeC is crucial for understanding the complete functional landscape of B. subtilis, an organism known for its remarkable adaptability across diverse environments .

How does YxeC compare to other uncharacterized proteins in B. subtilis?

YxeC belongs to the broader category of uncharacterized or hypothetical proteins in B. subtilis. Unlike proteins such as YciC, which has been postulated to function as a metallochaperone involved in zinc homeostasis , YxeC's function remains more obscure. When studying uncharacterized proteins, researchers should employ comparative genomic approaches to identify potential orthologs in related organisms. Sequence similarity searches, domain analyses, and phylogenetic profiling can provide initial clues to potential functions. For meaningful comparisons, researchers should analyze expression patterns across different growth conditions to identify co-regulated genes that might suggest functional relationships.

What information can be derived from the genomic context of the yxeC gene?

The genomic context analysis provides crucial insights into potential functional associations of uncharacterized proteins. Although specific information about yxeC's genomic context is limited in the provided search results, researchers can examine neighboring genes to identify potential operons or functionally related gene clusters. Similar to how the yciC gene in B. subtilis is regulated by the Zur protein as part of the zinc homeostasis mechanism , researchers should investigate whether yxeC is part of a regulatory network. Techniques such as RNA-seq can reveal co-transcribed genes, while ChIP-seq can identify transcription factors binding near the yxeC promoter. The genomic neighborhood of uncharacterized genes often provides the first clues toward functional annotation.

What are the optimal expression systems for recombinant YxeC protein production?

The recombinant production of YxeC protein has been successfully achieved in both E. coli and yeast expression systems . For optimal expression, consider the following methodological approaches:

Expression System Comparison:

ParameterE. coli SystemYeast System
Expression levelHigh yield for soluble expressionModerate yield with enhanced folding
Post-translational modificationsLimitedMore extensive eukaryotic modifications
Growth conditions37°C, induction with IPTG (0.1-1.0 mM)30°C, induction with galactose or methanol
Expression time4-6 hours post-induction24-72 hours post-induction
Codon optimizationMay be necessary for rare codonsLess critical but beneficial
Solubility enhancementFusion partners (MBP, SUMO, GST)Alpha-factor secretion signal

For uncharacterized proteins like YxeC, it is advisable to test multiple expression constructs in parallel, varying parameters such as purification tags (His-tag is commonly used ), fusion partners, and expression temperatures to optimize soluble protein yield. If protein function studies are planned, ensure that the chosen purification tag does not interfere with the protein's potential activity or structure.

What purification strategies are most effective for recombinant YxeC protein with a His-tag?

Purification of His-tagged YxeC protein requires a systematic approach to ensure high purity while maintaining potential biological activity. Based on standard protocols for His-tagged proteins and the available information about YxeC , the following purification strategy is recommended:

  • Immobilized Metal Affinity Chromatography (IMAC): Use Ni-NTA or Co-NTA resins with a binding buffer containing 20-50 mM imidazole to reduce non-specific binding.

  • Buffer Optimization: Since YxeC's function is unknown, test multiple buffer conditions (varying pH, salt concentration, and additives) to identify those that promote stability.

  • Secondary Purification: Follow IMAC with size exclusion chromatography to achieve higher purity and to analyze oligomeric state.

  • Quality Control Assessment:

    • Purity evaluation via SDS-PAGE (aim for >80% as specified for commercial preparations )

    • Western blot confirmation with anti-His antibodies

    • Mass spectrometry verification of protein identity

    • Dynamic light scattering to assess homogeneity

  • Storage Considerations: Store in PBS buffer as indicated in commercial preparations , with aliquots at -80°C for long-term storage. Perform stability tests at different temperatures to determine optimal storage conditions.

How can researchers troubleshoot poor expression or solubility issues with YxeC protein?

When encountering expression or solubility challenges with uncharacterized proteins like YxeC, implement the following methodological interventions:

  • Expression Optimization:

    • Test induction at lower temperatures (16-25°C) to slow folding and reduce inclusion body formation

    • Reduce inducer concentration to decrease expression rate

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

  • Solubility Enhancement:

    • Test multiple solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Screen various lysis buffer compositions with different additives:

      • Detergents (0.1-1% Triton X-100, CHAPS, or NP-40)

      • Stabilizing agents (5-10% glycerol, 0.1-0.5M arginine)

      • Reducing agents (1-5mM DTT or β-mercaptoethanol)

  • Alternative Approaches:

    • Consider cell-free expression systems for problematic proteins

    • Produce the protein in segments if specific domains are of interest

    • Employ directed evolution approaches to generate more soluble variants

  • Refolding Strategies: If inclusion bodies persist, develop a refolding protocol:

    • Solubilize inclusion bodies in 6-8M urea or guanidine hydrochloride

    • Perform stepwise dialysis with decreasing denaturant concentration

    • Add molecular chaperones during refolding to increase yield

What bioinformatic approaches can predict potential functions of YxeC?

For uncharacterized proteins like YxeC, comprehensive bioinformatic analysis provides crucial initial insights before experimental investigation:

  • Sequence-Based Predictions:

    • Homology detection using sensitive methods like PSI-BLAST and HHpred

    • Motif discovery using MEME suite, similar to approaches used for transcription factor binding site identification

    • Domain identification through Pfam, InterPro, and CDD databases

    • Secondary structure prediction (PSIPRED, JPred)

    • Disorder prediction (DISOPRED, IUPred)

  • Structural Prediction:

    • Template-based modeling if distant homologs exist

    • Ab initio modeling using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to predict stability and potential binding pockets

  • Functional Inference:

    • Gene neighborhood analysis to identify conserved genomic context

    • Co-expression network construction from public transcriptomic datasets

    • Prediction of subcellular localization (similar to the cell wall association determined for YoeB )

    • Analysis of conservation patterns to identify functionally important residues

  • Integration of Multiple Approaches:

    • Combine results from various tools using consensus methods

    • Weight predictions based on confidence scores and evolutionary conservation

What experimental approaches should be used to determine the cellular localization of YxeC?

Determining the cellular localization of an uncharacterized protein like YxeC provides critical insights into its potential function. Based on methodologies applied to other B. subtilis proteins like YoeB, which was identified as a cell wall-associated protein , the following systematic approach is recommended:

  • Fluorescence Microscopy:

    • Generate YxeC-GFP/YFP fusion constructs to visualize localization in live cells

    • Use time-lapse microscopy to track dynamic localization during different growth phases

    • Co-localize with compartment-specific markers for cell membrane, cell wall, nucleoid, and cytoplasm

  • Subcellular Fractionation:

    • Separate B. subtilis cellular compartments (cytoplasm, membrane, cell wall, secreted fractions)

    • Detect YxeC by Western blotting in different fractions using anti-His antibodies

    • Quantify distribution across fractions using densitometry

  • Immunoelectron Microscopy:

    • Generate specific antibodies against YxeC or use anti-His antibodies

    • Visualize precise subcellular localization at nanometer resolution

    • Quantify gold particle distribution to determine predominant localization

  • Proteomic Analysis:

    • Perform quantitative proteomics on isolated subcellular fractions

    • Use label-free quantification or SILAC approaches for relative abundance measurements

    • Compare localization patterns under different growth conditions

How can researchers investigate potential regulatory mechanisms controlling yxeC expression?

Understanding the regulation of uncharacterized genes provides insights into their biological context and function. Similar to the detailed regulatory analysis of the yciC gene in B. subtilis, which is controlled by the Zur protein in response to zinc levels , researchers can employ these approaches to investigate yxeC regulation:

  • Promoter Analysis and Transcription Start Site Mapping:

    • Perform 5' RACE to precisely determine transcription start sites

    • Create promoter-reporter fusions (e.g., lacZ) to measure expression levels

    • Create systematic promoter deletion constructs to identify regulatory elements

  • Identification of Regulatory Proteins:

    • Perform DNA-affinity chromatography using the yxeC promoter region

    • Employ ChIP-seq to identify transcription factors binding to the yxeC promoter

    • Use bacterial one-hybrid or EMSA to confirm direct interactions

  • Expression Analysis Under Various Conditions:

    • Monitor expression using qRT-PCR across growth phases

    • Test different stress conditions (similar to antibiotic stress for YoeB )

    • Examine expression in regulatory mutant backgrounds

  • Global Regulatory Network Integration:

    • Perform RNA-seq in wild-type and relevant regulatory mutants

    • Construct a gene regulatory network model incorporating yxeC

    • Validate predictions with targeted gene deletions and complementation

What phenotypic assays are appropriate for characterizing ΔyxeC mutants in B. subtilis?

When investigating the function of uncharacterized genes like yxeC through mutant analysis, a comprehensive phenotypic characterization approach is essential:

  • Growth Analysis:

    • Monitor growth curves in various media (rich, minimal, defined with different carbon sources)

    • Test growth under different stress conditions (temperature, pH, osmotic stress)

    • Examine growth with metal limitation or excess (particularly zinc, given the regulatory connections to zinc homeostasis in B. subtilis )

  • Morphological Characterization:

    • Phase contrast and fluorescence microscopy to assess cell shape and size

    • Transmission electron microscopy to examine ultrastructural changes

    • Fluorescent D-amino acid staining to visualize peptidoglycan synthesis patterns

  • Physiological Assays:

    • Assess sporulation efficiency (given B. subtilis is an endospore-forming bacterium )

    • Measure resistance to environmental stresses (similar to the autolysis tests performed for YoeB mutants )

    • Biofilm formation capacity on different surfaces

  • Molecular Phenotyping:

    • Comparative transcriptomics (RNA-seq) between wild-type and ΔyxeC

    • Proteomics analysis to identify compensatory protein expression changes

    • Metabolomics to detect altered metabolic profiles

  • Evolutionary Experiments:

    • Laboratory evolution experiments under selective pressures (as described for B. subtilis adaptation studies )

    • Suppressor mutant screening to identify genetic interactions

How can potential protein interaction partners of YxeC be identified?

Identifying protein interaction partners is crucial for understanding the functional context of uncharacterized proteins. The following methodological approaches should be considered:

  • Affinity Purification Coupled with Mass Spectrometry:

    • Express His-tagged YxeC in B. subtilis

    • Perform crosslinking in vivo to capture transient interactions

    • Use quantitative proteomics approaches (SILAC, TMT) to distinguish specific from non-specific interactions

    • Validate top candidates through reciprocal pull-downs

  • Bacterial Two-Hybrid Screening:

    • Create a genomic library fused to one domain of the two-hybrid system

    • Screen against YxeC fused to the complementary domain

    • Sequence positive colonies to identify interacting partners

  • Proximity-Based Labeling:

    • Generate YxeC fusions with enzymes like BioID or APEX2

    • Identify proximal proteins through biotinylation and streptavidin pull-down

    • Analyze by mass spectrometry to map the proximal proteome

  • Co-expression Network Analysis:

    • Identify genes co-expressed with yxeC across multiple conditions

    • Focus on genes with strong correlation coefficients as potential functional partners

    • Validate through genetic interaction studies

Data Interpretation Framework:

ApproachAdvantagesLimitationsData Analysis Method
AP-MSCaptures in vivo complexesMay miss transient interactionsSAINT or CRAPome filtering
Bacterial two-hybridDetects direct interactionsPotential false positivesMultiple validation methods required
Proximity labelingIdentifies spatial relationshipsMay label proximal but non-interacting proteinsComparison to control labeling experiments
Co-expressionGenome-wide scopeCorrelation doesn't imply direct interactionNetwork analysis algorithms

What approaches can determine if YxeC plays a role in zinc homeostasis in B. subtilis?

Given that some uncharacterized proteins in B. subtilis are involved in zinc homeostasis, such as YciC which is regulated by the Zur protein , it is reasonable to investigate if YxeC may have a similar role. The following experimental approaches are recommended:

  • Metal Binding Characterization:

    • Purify recombinant YxeC protein and perform metal content analysis using ICP-MS

    • Conduct isothermal titration calorimetry (ITC) to determine binding affinities for various metals

    • Perform differential scanning fluorimetry with and without metals to assess thermal stability changes

  • Metal-Dependent Expression Analysis:

    • Monitor yxeC expression using qRT-PCR under varying zinc concentrations

    • Compare expression patterns in wild-type and Δzur mutant backgrounds

    • Perform ChIP-seq to determine if Zur binds to the yxeC promoter region

  • Metal Homeostasis Phenotypes:

    • Measure intracellular zinc content in wild-type versus ΔyxeC strains

    • Test sensitivity to zinc limitation and excess in ΔyxeC versus wild-type

    • Examine genetic interactions with known zinc homeostasis genes through double mutant analysis

  • Structural Analysis:

    • Identify potential metal-binding motifs through structural prediction

    • Generate site-directed mutants of predicted binding residues

    • Assess functional consequences of mutations on metal binding and in vivo phenotypes

How can researchers design experiments to resolve contradictory data about YxeC function?

When faced with contradictory experimental results regarding an uncharacterized protein's function, a systematic approach to resolve discrepancies is essential:

  • Critical Evaluation of Methodological Differences:

    • Compare experimental conditions, strains, and methodologies between contradictory studies

    • Identify variables that might explain differences (growth conditions, tags used, expression levels)

    • Replicate key experiments with standardized protocols across multiple laboratories

  • Orthogonal Validation Approaches:

    • Deploy multiple independent techniques to assess the same functional hypothesis

    • Design experiments that test function through different biological readouts

    • Use complementary in vitro and in vivo approaches to bridge methodological gaps

  • Conditional Functionality Testing:

    • Test protein function under various environmental conditions

    • Create chimeric proteins or domain swaps to identify functional regions

    • Employ tunable expression systems to assess dose-dependent effects

  • Genetic Background Considerations:

    • Examine effects in multiple B. subtilis strain backgrounds

    • Test complementation with orthologs from related species

    • Create a clean genetic background by removing potentially compensatory pathways

  • Decision Framework for Resolving Contradictions:

Type of ContradictionPotential CausesResolution Strategy
Different subcellular localizationTagging artifacts, growth conditionsValidate with multiple tagging strategies and native antibodies
Conflicting phenotypesStrain differences, secondary mutationsWhole genome sequencing of strains, precise genetic reconstruction
Inconsistent biochemical activitiesProtein preparation methods, contaminantsActivity testing with multiple purification approaches
Opposing regulatory dataGrowth phase differences, media compositionStandardized conditions with time-course analysis

How can researchers use evolutionary approaches to understand YxeC function?

Evolutionary approaches provide powerful insights into protein function by examining conservation patterns and adaptive significance. For uncharacterized proteins like YxeC, these methodologies are particularly valuable:

  • Comparative Genomics Analysis:

    • Identify YxeC orthologs across bacterial species using sensitive homology detection methods

    • Analyze gene neighborhood conservation to identify functionally linked genes

    • Examine co-evolution patterns with known functional partners

  • Laboratory Evolution Experiments:

    • Subject B. subtilis to selective pressures that might reveal YxeC function (similar to the experimental evolution approaches described for B. subtilis )

    • Compare evolution trajectories between wild-type and ΔyxeC strains

    • Sequence evolved populations to identify compensatory mutations in ΔyxeC backgrounds

  • Evolutionary Rate Analysis:

    • Calculate evolutionary rates (dN/dS) to identify conserved functional regions

    • Perform site-specific evolutionary analyses to detect residues under positive selection

    • Correlate evolutionary constraints with structural predictions

  • Ancestral Sequence Reconstruction:

    • Infer and synthesize ancestral versions of YxeC

    • Compare biochemical properties of ancestral and extant proteins

    • Identify functionally important evolutionary transitions

What cutting-edge technologies can be applied to characterize YxeC structure-function relationships?

For challenging uncharacterized proteins like YxeC, emerging technologies offer new avenues for structure-function determination:

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of purified YxeC protein

    • Visualize YxeC in complex with potential interaction partners

    • Analyze conformational states under different conditions

  • Integrative Structural Biology:

    • Combine X-ray crystallography, NMR, and computational modeling

    • Use hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Apply cross-linking mass spectrometry to identify domain interactions

  • Single-Molecule Approaches:

    • Employ FRET to detect conformational changes upon ligand binding

    • Use optical tweezers to measure mechanical properties

    • Apply single-molecule tracking in live cells to monitor dynamics

  • High-Throughput Mutagenesis:

    • Perform deep mutational scanning to map functional residues

    • Use CRISPR-based genome editing for precise chromosomal mutations

    • Develop activity-based selections to isolate functional variants

  • Advanced Computational Methods:

    • Apply molecular dynamics simulations to predict binding pockets

    • Use machine learning to integrate multiple data types for function prediction

    • Develop custom scoring functions to assess potential functions based on structural features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.