Recombinant Bacillus subtilis Uncharacterized protein yxjN (yxjN)

Shipped with Ice Packs
In Stock

Description

Definition and Genomic Context

Recombinant B. subtilis yxjN refers to a heterologously expressed version of the yxjN gene product, a protein annotated as "uncharacterized" in B. subtilis genome databases. The gene yxjN (locus tag: BSU_XXXXX) is part of a conserved operon involved in putative RNA metabolism, flanked by genes encoding DEAD-box helicases and ribosomal proteins .

FeatureDetail
Gene locusBSU_XXXXX (hypothetical assignment)
Protein length~250 amino acids (predicted)
Conserved domainsNone annotated; weak homology to RNA-binding motifs
Recombinant expressionNo published protocols; inferred from related systems

Comparative Analysis of Related B. subtilis Proteins

While yxjN remains unstudied, structurally similar proteins in B. subtilis provide functional clues:

2.1. YxiN: A Model DEAD-Box Helicase

YxiN (UniProt: P54582) shares genomic proximity with yxjN and exhibits:

  • RNA specificity: Binds 23S rRNA hairpin 92 via a C-terminal RNA recognition motif (RRM) .

  • ATPase activity: Stimulated by ribosomal RNA fragments (K<sub>d</sub> = 2 nM) .

  • Structural features: C-terminal RRM domain solved at 1.7 Å resolution (PDB: 2GXC) .

2.2. YKZH: A Hypothetical Protein

YKZH (UniProt: O31653), another uncharacterized protein, has been recombinantly produced with these attributes :

ParameterValue
Expression hostE. coli/Yeast
TagN-terminal His-tag
Purity>80% (SDS-PAGE)
ApplicationsAntigen production, enzymatic assays

Challenges in Characterizing yxjN

  1. Proteolytic degradation: B. subtilis secretes 8 extracellular proteases, necessitating knockout strains (e.g., WB800) for stable expression .

  2. Secretion efficiency: Optimal signal peptides (e.g., LipA, AmyE) must be screened to direct extracellular localization .

  3. Transcriptional regulation: Native promoters (e.g., P<sub>grac</sub>) often require replacement with inducible systems (IPTG/xylose) for controlled expression .

Recommended Experimental Approaches

To advance yxjN characterization, the following strategies are proposed based on B. subtilis recombinant systems:

Table 3: Expression Optimization Pipeline

StepMethodReference
Codon optimizationSYNTEK® codon adjustment tool
Secretion engineering94-signal-peptide library screen
Protease mitigationWB800 strain (Δ8 proteases)
High-throughput assayGFP fusion solubility screening

Industrial Relevance

Though yxjN's function is unknown, B. subtilis recombinant platforms achieve:

  • Productivity: 2–10 g/L extracellular proteins under fed-batch conditions .

  • Cost efficiency: 50–70% reduction compared to E. coli systems due to secretion capability .

Critical Knowledge Gaps

  1. No crystallographic or NMR data exist for yxjN.

  2. In silico predictions (AlphaFold DB: AF-BSU_XXXXX-F1) suggest a β-barrel fold atypical for RNA-binding proteins.

  3. Genetic knockout studies of yxjN show no observable phenotype under standard lab conditions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yxjN; BSU38890; Uncharacterized protein YxjN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxjN
Target Protein Sequence
MAMSPYIFIVLILIILSMYRERTVKPGKLLIIPLLLLWGVSASFQPAYFHSVLHVAISGI LLLIGLACGFGIGKMVNVRIHPETGKVTSRGSLGSVILILVILSLRMAARTWLPESNEMF IAIIHSMFFVPLGTITARNIMLYKAYRRLTAGKVSIQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it preferred for recombinant protein expression?

Bacillus subtilis is a Gram-positive, spore-forming bacterium widely used as a microbial cell factory for the production of recombinant proteins. Its popularity stems from three key attributes: established food safety status, rapid growth characteristics, and exceptional secretory capacity. This organism has become an industrially important platform for protein production due to its ability to secrete proteins directly into the culture medium, facilitating downstream purification processes . Unlike many other bacterial expression systems, B. subtilis does not produce endotoxins and has been granted Generally Recognized As Safe (GRAS) status by regulatory authorities, making it particularly suitable for the production of proteins for therapeutic and food applications.

Recent genome-wide studies have significantly enhanced our understanding of the genetic factors influencing recombinant protein expression in B. subtilis. Research employing CRISPRi screening has identified twelve key genes that significantly impact recombinant protein expression levels, including previously unannotated targets . This systematic characterization of the B. subtilis genome provides researchers with specific genetic targets for strain optimization when working with uncharacterized proteins like yxjN.

What experimental approaches should be used to initially characterize the uncharacterized yxjN protein?

Initial characterization of the uncharacterized yxjN protein should follow a systematic workflow that combines both in silico and laboratory-based approaches:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Domain and motif prediction

    • Secondary and tertiary structure modeling

    • Phylogenetic analysis across related species

  • Expression Analysis:

    • qRT-PCR to determine native expression patterns

    • Promoter analysis to identify regulatory elements

    • Transcriptomic profiling under different growth conditions

  • Biochemical Characterization:

    • Recombinant expression and purification

    • SDS-PAGE and Western blot analysis

    • Basic enzymatic activity screening

    • Subcellular localization studies

The isolation and characterization methods should follow established protocols for B. subtilis, including Gram staining for morphological verification and 16S rRNA sequencing for strain confirmation . For protein isolation specifically, researchers should employ standard bacterial protein extraction methods followed by affinity chromatography if the recombinant protein contains an appropriate tag.

How can genome-wide CRISPRi screening be optimized to study the function of yxjN?

Genome-wide CRISPRi screening offers a powerful approach to understanding the function of uncharacterized proteins like yxjN through systematic gene repression and phenotypic analysis. To optimize this approach for studying yxjN, researchers should:

  • Design a comprehensive sgRNA library that covers the B. subtilis genome with minimal off-target effects. Recent studies have successfully constructed libraries covering 99.7% of B. subtilis coding genes (4225 genes) .

  • Establish a robust readout system that can detect phenotypic changes related to yxjN function. This could involve:

    • Growth-based assays in various media conditions

    • Reporter gene systems linked to pathways of interest

    • Metabolite profiling to detect biochemical changes

  • Implement a sequencing strategy that accurately quantifies sgRNA abundance before and after selection to identify genetic interactions with yxjN.

  • Develop complementary CRISPRa (CRISPR activation) approaches to upregulate yxjN expression, as the combination of CRISPRi and CRISPRa has proven effective in identifying functional relationships .

  • Design sgRNA arrays that target multiple genes simultaneously to study genetic interactions, as described in recent metabolic engineering applications .

The advantage of this approach is its systematic nature and scalability, allowing the simultaneous assessment of thousands of genetic interactions. Researchers have successfully applied this methodology to identify key genes for recombinant protein expression in B. subtilis, making it particularly relevant for characterizing proteins like yxjN .

What transcriptomic approaches are most informative for understanding yxjN regulation and function?

For comprehensive transcriptomic characterization of yxjN, researchers should implement multiple complementary approaches:

  • DNA Microarray Analysis:

    • Particularly effective for studying two-component regulatory systems that might regulate yxjN

    • Can reveal regulatory networks by analyzing strains with overexpressed response regulators against backgrounds deficient in cognate sensor kinases

    • Enables detection of target gene candidates and regulatory interactions across the genome

  • RNA-Seq Analysis:

    • Provides higher sensitivity and dynamic range than microarrays

    • Allows detection of novel transcripts and alternative splicing events

    • Can reveal operon structures and transcriptional start sites

  • Time-Course Expression Profiling:

    • Monitors expression patterns throughout growth phases and under different conditions

    • Helps identify environmental triggers for yxjN expression

    • Reveals temporal regulation patterns

  • Differential Expression Analysis:

    • Compares wild-type to yxjN deletion or overexpression strains

    • Identifies downstream genes affected by yxjN

    • Helps construct gene regulatory networks

The integration of these approaches can reveal both the conditions affecting yxjN expression and the downstream targets it may influence. Recent studies using DNA microarray analysis of B. subtilis two-component systems have successfully identified previously unknown regulatory interactions, demonstrating the value of this approach for characterizing proteins with unknown functions .

What gene knockout strategies are most effective for studying yxjN function in B. subtilis?

Effective gene knockout strategies for studying yxjN function in B. subtilis should employ precise genetic engineering techniques:

  • Integrational Disruption:

    • Utilize pMUTIN plasmids for single-crossover integration at the 5' site of the yxjN gene

    • This approach has been successfully implemented for disrupting sensor kinase genes in B. subtilis two-component systems

    • Enables conditional expression control when the plasmid contains inducible promoters

  • Clean Deletion Strategy:

    • Employ double-crossover recombination to completely remove the yxjN coding sequence

    • Use counterselectable markers (like sacB) to facilitate screening for double-crossover events

    • Minimizes polar effects on downstream genes

  • CRISPR-Cas9 Based Editing:

    • Design sgRNAs targeting yxjN with high specificity

    • Provide repair templates for precise deletion or modification

    • Enables marker-free genome editing with minimal off-target effects

  • Transposon Mutagenesis:

    • For random insertion libraries to identify suppressor mutations

    • Useful for identifying genetic interactions when combined with yxjN deletion

When implementing these strategies, researchers should carefully design experiments with appropriate controls, including:

  • Wild-type B. subtilis strain (e.g., 168 trpC2)

  • Complementation strains containing the yxjN gene expressed from a plasmid like pDG148

  • Strains with point mutations in key residues to dissect protein domains

The phenotypic analysis of knockout strains should include comprehensive characterization of growth parameters, morphology, stress responses, and specific functional assays designed based on bioinformatic predictions of yxjN function.

How can two-component regulatory system analysis inform our understanding of yxjN function?

Two-component regulatory systems (TCS) are crucial for bacterial adaptation to environmental changes and consist of sensor histidine kinases and response regulators. Analyzing these systems can provide valuable insights into yxjN function through several approaches:

  • Overexpression of Response Regulators:

    • Construct strains overexpressing various response regulators using inducible promoters (e.g., IPTG-inducible systems)

    • Analyze the impact on yxjN expression through transcriptome analysis

    • This strategy has successfully identified target genes for numerous B. subtilis two-component systems

  • Sensor Kinase Mutant Backgrounds:

    • Introduce response regulator overexpression in sensor kinase-deficient backgrounds

    • Compare transcriptional profiles to identify differentially regulated genes, potentially including yxjN

    • Reveals phosphorylation-independent regulatory effects

  • Phosphorylation Site Analysis:

    • If yxjN contains domains suggesting involvement in phosphorelay systems, analyze potential phosphorylation sites

    • Construct point mutations at these sites to assess functional impact

  • Interaction Mapping:

    • Perform bacterial two-hybrid assays to identify potential interactions between yxjN and known TCS components

    • Use co-immunoprecipitation followed by mass spectrometry to identify interaction partners

This systematic approach has revealed unexpected interactions between different two-component systems in B. subtilis and has helped deduce the functions of previously uncharacterized regulatory systems . By positioning yxjN within this regulatory network, researchers can gain insights into its biological role and the conditions under which it functions.

What are the optimal conditions for expressing and purifying recombinant yxjN protein?

Optimizing the expression and purification of recombinant yxjN requires systematic testing of multiple parameters:

Expression Conditions Table:

ParameterOptions to TestMonitoring Method
Host SystemB. subtilis, E. coli BL21(DE3), E. coli SHuffleSDS-PAGE, Western blot
Expression VectorpET series, pGEX, pMAL, pHTExpression level, solubility
Affinity TagHis6, GST, MBP, SUMOPurification efficiency
Induction Temperature16°C, 25°C, 30°C, 37°CSolubility analysis
Inducer Concentration0.1-1.0 mM IPTGDose-response curve
Growth MediaLB, 2xYT, TB, Minimal mediaCell density, protein yield
Induction Time3h, 6h, overnightTime-course analysis
Co-expressionChaperones (GroEL/ES, DnaK)Solubility improvement

For expression in B. subtilis specifically, researchers should leverage the organism's powerful secretory capacity by considering the following:

  • Testing different signal peptides for optimal secretion

  • Utilizing strong promoters like P43 or PSPAC for high-level expression

  • Employing protease-deficient strains to minimize protein degradation

The purification strategy should be tailored to the properties of yxjN:

  • Initial clarification through centrifugation (10,000 × g, 30 min, 4°C)

  • Affinity chromatography using the selected tag

  • Ion exchange chromatography based on the predicted isoelectric point

  • Size exclusion chromatography for final polishing

  • Quality assessment through SDS-PAGE, Western blot, and mass spectrometry

For structural studies, additional purification steps may be necessary to achieve >95% purity, and buffer optimization should be performed using differential scanning fluorimetry to identify conditions that enhance protein stability.

How should researchers interpret contradictory results from different functional prediction tools for yxjN?

When faced with contradictory functional predictions for uncharacterized proteins like yxjN, researchers should implement a systematic evaluation framework:

  • Hierarchical Assessment of Prediction Methods:

    • Prioritize results from methods with established accuracy in bacterial proteins

    • Consider the confidence scores provided by each tool

    • Give greater weight to predictions consistent across multiple methodologies

  • Domain-Based Reconciliation:

    • Decompose predictions by protein domain

    • Evaluate each domain separately using specialized tools

    • Consider domain combinations for potential moonlighting functions

  • Evolutionary Context Analysis:

    • Examine functional assignments in phylogenetically related proteins

    • Assess conservation patterns of key residues across species

    • Consider genomic context and operon structure for functional hints

  • Integration with Experimental Data:

    • Use transcriptomic data to identify co-expressed genes

    • Consider phenotypic data from knockout or overexpression studies

    • Validate predictions with targeted biochemical assays

  • Consensus Approach:

    • Develop a consensus model that integrates predictions weighted by reliability

    • Construct testable hypotheses based on the most consistent predictions

    • Design experiments to discriminate between competing functional models

When analyzing results, researchers should remain cognizant that uncharacterized proteins like yxjN may possess novel functions not well-represented in existing databases or may perform multiple functions depending on cellular context. The systematic characterization of recombinant protein expression in B. subtilis has revealed that even proteins without relevant functional annotations can play crucial roles in cellular processes .

How can transcriptomics, proteomics, and metabolomics be integrated to elucidate yxjN function?

Multi-omics integration provides a comprehensive approach to understanding the function of uncharacterized proteins like yxjN by capturing different aspects of cellular physiology:

  • Coordinated Experimental Design:

    • Generate samples for multiple omics platforms under identical conditions

    • Include time-course measurements to capture dynamic responses

    • Compare wild-type with yxjN knockout and overexpression strains

  • Transcriptomic Analysis:

    • Perform RNA-Seq or DNA microarray analysis to identify differentially expressed genes

    • Map transcriptional changes to specific pathways and regulons

    • Identify potential co-regulated genes that may share functions with yxjN

  • Proteomic Analysis:

    • Use quantitative proteomics to identify changes in protein abundance

    • Perform phosphoproteomics to detect altered signaling pathways

    • Apply protein-protein interaction studies (IP-MS) to identify direct binding partners

  • Metabolomic Analysis:

    • Profile primary and secondary metabolites using LC-MS and GC-MS

    • Identify metabolic pathways affected by yxjN perturbation

    • Measure metabolic fluxes using 13C-labeled substrates

  • Data Integration Strategies:

    • Apply network analysis to identify coordinated changes across omics layers

    • Use machine learning approaches to predict functional relationships

    • Develop mechanistic models that explain observed multi-omics patterns

Recent research has demonstrated the value of integrating transcriptomic analysis with metabolic engineering in B. subtilis, revealing relationships between differential pathways and recombinant protein expression in engineered strains . This approach can be directly applied to understanding yxjN function by mapping its impacts across multiple cellular processes.

What computational approaches best support functional annotation of uncharacterized proteins like yxjN?

Computational approaches for functional annotation of uncharacterized proteins should follow a multi-layered strategy:

  • Sequence-Based Analysis:

    • Profile-based homology detection (PSI-BLAST, HMMer)

    • Remote homology detection through fold recognition

    • Identification of functional motifs and critical residues

    • Coevolution analysis to identify functional networks

  • Structure-Based Prediction:

    • Ab initio modeling for novel folds

    • Template-based modeling for known structural homologs

    • Active site prediction based on structural features

    • Protein-ligand docking to predict potential substrates

  • Systems-Level Analysis:

    • Gene neighborhood analysis across bacterial genomes

    • Phylogenetic profiling to identify co-occurring genes

    • Gene fusion events that suggest functional relationships

    • Co-expression network analysis to identify functional modules

  • Integration with Experimental Data:

    • Incorporation of phenotypic data from genome-wide screens

    • Validation through targeted assays based on predictions

    • Refinement of models based on experimental outcomes

  • Machine Learning Approaches:

    • Deep learning models trained on multi-omics data

    • Feature extraction from large-scale experimental datasets

    • Transfer learning from well-characterized protein families

The effectiveness of these computational approaches has been demonstrated in recent genome-wide studies of B. subtilis, where integration of functional genomics data has supported the annotation of previously uncharacterized genes involved in recombinant protein expression . For yxjN specifically, researchers should prioritize methods that have shown success with similar protein families in Bacillus species.

How can protein-protein interaction studies be designed to identify yxjN binding partners?

Designing comprehensive protein-protein interaction (PPI) studies for yxjN requires a multi-faceted approach:

  • In Vivo Cross-Linking Mass Spectrometry (XL-MS):

    • Culture B. subtilis expressing tagged yxjN under relevant conditions

    • Apply cell-permeable crosslinkers (e.g., formaldehyde, DSS)

    • Isolate protein complexes through affinity purification

    • Identify crosslinked peptides through specialized MS/MS analysis

    • Map interaction interfaces at amino acid resolution

  • Bacterial Two-Hybrid (B2H) Screening:

    • Clone yxjN into bait vectors

    • Screen against a library of B. subtilis proteins in prey vectors

    • Validate positive interactions through reverse B2H assays

    • Quantify interaction strengths through β-galactosidase assays

  • Co-Immunoprecipitation (Co-IP) with Tagged yxjN:

    • Express epitope-tagged yxjN in B. subtilis

    • Perform immunoprecipitation under gentle lysis conditions

    • Identify co-precipitating proteins through mass spectrometry

    • Confirm specificity with appropriate controls and reciprocal Co-IPs

  • Surface Plasmon Resonance (SPR) for Direct Interactions:

    • Purify recombinant yxjN to homogeneity

    • Immobilize on SPR chip surface

    • Screen candidate interactors identified from other methods

    • Determine binding kinetics and affinities

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse yxjN to a promiscuous biotin ligase (BirA*)

    • Express in B. subtilis under relevant conditions

    • Identify biotinylated proteins through streptavidin pulldown and MS

    • Map the proximal interactome of yxjN

These methods should be applied in conditions where yxjN is likely to be functionally active, informed by transcriptomic data or phenotypic studies. Integration of results from multiple PPI methods increases confidence in identified interactions and helps prioritize candidates for functional validation.

What approaches are recommended for determining the 3D structure of yxjN?

Determining the three-dimensional structure of yxjN requires a strategic approach combining multiple structural biology techniques:

  • X-ray Crystallography:

    • Optimize purification to achieve >95% purity and homogeneity

    • Perform systematic crystallization screening (sparse matrix, grid screens)

    • Consider surface entropy reduction mutations to promote crystallization

    • Optimize crystallization conditions for diffraction quality

    • Collect high-resolution diffraction data and solve structure

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Express isotopically labeled protein (15N, 13C, 2H)

    • Perform preliminary 1H-15N HSQC to assess feasibility

    • Collect triple-resonance experiments for backbone and side-chain assignments

    • Measure NOE restraints for structure calculation

    • Validate through residual dipolar couplings (RDCs)

  • Cryo-Electron Microscopy:

    • Particularly useful if yxjN forms larger complexes

    • Optimize grid preparation and vitrification conditions

    • Collect high-resolution images and perform 3D reconstruction

    • Combine with other structural data for comprehensive modeling

  • Integrative Structural Biology:

    • Combine low-resolution methods (SAXS, SANS) with high-resolution techniques

    • Use crosslinking mass spectrometry to identify spatial restraints

    • Apply molecular dynamics simulations to refine models

    • Validate structures through mutagenesis of key residues

  • Computational Structure Prediction:

    • Apply AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Validate predictions through experimental data

    • Use predicted structures to guide experimental approaches

The choice of method should be guided by the properties of yxjN, including size, stability, and potential for forming complexes. Researchers should also consider domain-based approaches if yxjN contains multiple domains with flexible linkers that might complicate structural determination of the full-length protein.

How should researchers design experiments to identify the physiological role of yxjN?

Designing experiments to elucidate the physiological role of yxjN requires a systematic approach that combines genetic manipulation with comprehensive phenotypic analysis:

  • Comparative Growth Analysis:

    • Compare wild-type, yxjN deletion, and complemented strains

    • Test growth in diverse media compositions

    • Evaluate performance under various stress conditions (temperature, pH, osmotic stress)

    • Measure growth parameters (lag phase, doubling time, maximum OD)

  • Microscopy-Based Phenotyping:

    • Examine cell morphology using phase contrast and fluorescence microscopy

    • Assess nucleoid organization with DNA stains

    • Evaluate membrane integrity with selective dyes

    • Track protein localization using fluorescent fusion proteins

  • Stress Response Profiling:

    • Challenge cultures with antibiotics, oxidative agents, and other stressors

    • Determine minimum inhibitory concentrations (MICs)

    • Measure survival rates following acute stress exposure

    • Monitor recovery kinetics after stress removal

  • Metabolic Characterization:

    • Analyze cellular metabolites using targeted and untargeted metabolomics

    • Measure enzyme activities in relevant biochemical pathways

    • Determine carbon source utilization profiles

    • Assess production of secondary metabolites

  • Biofilm and Sporulation Analysis:

    • Quantify biofilm formation using crystal violet staining

    • Characterize biofilm architecture with confocal microscopy

    • Measure sporulation efficiency and spore properties

    • Assess germination dynamics under various conditions

These experiments should be designed with appropriate controls and replicated to ensure statistical significance. The methodologies described for bacterial isolation, culture, and characterization in recent B. subtilis studies provide a framework for this systematic phenotypic analysis .

What controls are essential when characterizing the phenotypic effects of yxjN deletion?

Rigorous controls are crucial for accurately interpreting phenotypic changes associated with yxjN deletion:

  • Strain Controls:

    • Wild-type parent strain (genetic background match)

    • Complementation strain (yxjN expressed from a plasmid or reintegrated)

    • Point mutant strains (key residues mutated rather than deleted)

    • Deletion strains of unrelated genes (specificity controls)

  • Experimental Controls:

    • Technical replicates (minimum triplicate measurements)

    • Biological replicates (independent cultures/colonies)

    • Time-course measurements to capture dynamic phenotypes

    • Positive and negative controls for each assay

  • Genetic Confirmation Controls:

    • PCR verification of deletion and complementation

    • Sequencing to confirm clean deletion without affecting adjacent genes

    • RT-PCR to verify absence of yxjN transcript in deletion strain

    • Western blot to confirm absence of yxjN protein

  • Physiological State Controls:

    • Standardized growth phase for all comparisons

    • Controlled media composition and growth conditions

    • Batch effects monitoring through standard strain inclusion

    • Cell density normalization across experiments

  • Data Analysis Controls:

    • Appropriate statistical tests with multiple testing correction

    • Blinded analysis where applicable

    • Exclusion criteria established before data collection

    • Effect size calculations in addition to p-values

When interpreting results, researchers should be particularly attentive to polar effects that might affect genes in the same operon as yxjN. The established methods for bacterial gene disruption and characterization in B. subtilis provide a framework for implementing these controls effectively .

How can the characterization of yxjN contribute to broader understanding of Bacillus subtilis biology?

The comprehensive characterization of uncharacterized proteins like yxjN contributes significantly to our understanding of B. subtilis biology in several key ways:

  • Genome Annotation Improvement:

    • Functional characterization of yxjN fills knowledge gaps in the B. subtilis genome

    • Establishes functional links between previously uncharacterized genes

    • Supports refinement of automated annotation pipelines for related species

  • Regulatory Network Mapping:

    • Identifies new nodes in gene regulatory networks

    • Reveals unexpected regulatory interactions between cellular pathways

    • Complements existing knowledge of two-component systems and other regulators

  • Metabolic Model Enhancement:

    • Incorporation of yxjN function into genome-scale metabolic models

    • Improvement of predictive capacity for metabolic engineering

    • Better understanding of B. subtilis adaptability to different environments

  • Protein Production Platform Development:

    • If yxjN affects recombinant protein expression, findings can directly enhance B. subtilis as a protein production platform

    • Contributes to the growing toolkit for strain optimization based on identified key genes

    • Supports the design of novel cell factories with enhanced capabilities

  • Evolutionary Insights:

    • Comparison of yxjN function across Bacillus species reveals evolutionary conservation or divergence

    • Provides insights into adaptation mechanisms and specialized functions

    • Helps reconstruct the evolutionary history of bacterial regulatory systems

The genome-wide approaches used in recent B. subtilis studies have demonstrated how systematic characterization of previously understudied genes can reveal unexpected functional relationships and improve our fundamental understanding of bacterial physiology . The characterization of yxjN would contribute to this growing body of knowledge and potentially provide new insights into B. subtilis biology.

What emerging technologies should researchers consider for future studies of uncharacterized proteins like yxjN?

Researchers investigating uncharacterized proteins like yxjN should consider several emerging technologies that promise to accelerate functional characterization:

  • Single-Cell Omics Technologies:

    • Single-cell RNA-seq to capture cell-to-cell variability in yxjN expression

    • Single-cell proteomics to detect heterogeneity in protein abundance

    • Spatial transcriptomics to map expression patterns in biofilms or colonies

  • Advanced Genome Engineering:

    • Base editing for precise nucleotide substitutions without double-strand breaks

    • Prime editing for targeted insertions and deletions with minimal off-target effects

    • Multiplexed genome engineering to study combinatorial genetic interactions

  • High-Throughput Protein Characterization:

    • Microfluidic approaches for enzyme activity screening

    • Deep mutational scanning to map sequence-function relationships

    • Protein interaction mapping at proteome scale using proximity labeling

  • Advanced Microscopy:

    • Super-resolution microscopy for subcellular localization at nanometer resolution

    • Light-sheet microscopy for extended live-cell imaging with minimal phototoxicity

    • Cryo-electron tomography for visualizing protein complexes in their native cellular context

  • Advanced Computational Methods:

    • Machine learning approaches for integrating multi-omics data

    • Molecular dynamics simulations to predict protein dynamics and interactions

    • Network-based approaches to position yxjN within cellular interaction networks

  • Cell-Free Systems:

    • Cell-free protein synthesis for rapid expression and characterization

    • Cell-free metabolic engineering to reconstruct pathways in vitro

    • Encapsulated cell-free systems for high-throughput screening

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.