Recombinant Bacillus subtilis Uncharacterized protein yxlC (yxlC)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Context of Recombinant Bacillus subtilis Uncharacterized Protein yxlC

Recombinant Bacillus subtilis Uncharacterized protein yxlC refers to a bioengineered form of the native yxlC protein, expressed heterologously in microbial hosts such as E. coli, yeast, or baculovirus systems. The protein is encoded by the yxlC gene (BSU38690) in B. subtilis and belongs to a genomic operon (sigYyxlCDEFG) linked to the extracytoplasmic function (ECF) sigma factor σY . While its precise biological function remains uncharacterized, genetic studies suggest its involvement in regulatory networks associated with σY activity .

Key Genetic Features

FeatureDescriptionSource
Operon StructurePart of the sigYyxlCDEFG operon, downstream of the σY gene.
Regulatory RoleDisruption of yxlC via transposon insertion initially suggested σY upregulation, but nonpolar mutations showed no derepression, indicating potential indirect effects .
Associated GenesCo-expressed with yxlD and yxlE, which directly regulate σY activity .

Functional Insights and Research Implications

Despite its availability as a recombinant product, functional studies on yxlC remain limited. Key findings from genetic analyses include:

  • Regulatory Interactions: The sigYyxlCDEFG operon is autoregulated by σY, and yxlC is positioned upstream of yxlD and yxlE, which encode proteins critical for σY activity .

  • Transcriptional Polarization: A transposon insertion in yxlC initially appeared to upregulate σY-dependent genes, but this effect was later attributed to transcriptional polarity rather than direct regulatory activity .

  • Genomic Context: yxlC is adjacent to genes encoding membrane-associated proteins (e.g., yxlE), suggesting potential roles in envelope stress responses or signal transduction .

Table 2: Functional Hypotheses for yxlC

HypothesisEvidenceLimitations
σY RegulatorProximity to σY and yxlD/E in operon .No direct interaction data
Membrane-AssociatedCo-expression with membrane proteins .No structural or localization data
Envelope Stress ResponseLink to ECF σY, which regulates cell wall stress .No phenotypic studies on yxlC mutants

Challenges and Future Directions

The lack of functional characterization for yxlC underscores the need for targeted research:

  1. Structural Analysis: Resolving the 3D structure of yxlC could reveal functional motifs or homologous domains.

  2. Interaction Mapping: Yeast two-hybrid or co-immunoprecipitation assays to identify binding partners.

  3. Phenotypic Studies: Generating B. subtilis ΔyxlC mutants to assess growth under stress conditions.

  4. Transcriptomic Profiling: Identifying downstream targets of yxlC using RNA-seq.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yxlC; BSU38690; Uncharacterized protein YxlC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxlC
Target Protein Sequence
MNKEKLSDHLKSEWKKIDQTANPSIPNQKELLHQLSQMKAEYRKKLLQEIILFVFCALMV VSAAILAFTQAPAVFIVLQVCVLAVLPILIAAEKKRHLGECEVKRG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis yxlC and what is known about its function?

Bacillus subtilis yxlC is a gene located within the sigY operon, which also contains sigY, yxlD, and yxlE genes. While fully characterized functions remain under investigation, research indicates that yxlC is positioned immediately downstream of sigY . The protein encoded by yxlC appears to be involved in regulatory pathways related to the extracytoplasmic function (ECF) sigma factor σY .

Bacillus subtilis, as a GRAS (Generally Recognized As Safe) organism classified by the FDA, provides an excellent model system for studying gene function in gram-positive bacteria. The organism exhibits various morphological stages observable under microscopy, from long threads to smaller motile cells, with endospore formation occurring under nutrient limitation .

What experimental approaches are recommended for initial characterization of yxlC?

Initial characterization of yxlC should employ a multilayered approach:

  • Gene Expression Analysis: Monitoring expression levels using reporter fusions (such as cat-lacZ) throughout growth phases. Data indicates that PY-cat-lacZ expression reaches maximum levels at late log phase (OD600 of 0.8) .

  • Genetic Disruption: Creating both polar and nonpolar mutations in yxlC to distinguish between direct effects and those caused by downstream gene disruption. Mini-Tn10 transposon insertions have been successfully used for this purpose .

  • Growth Conditions Assessment: Analyzing expression under various environmental conditions, since ECF sigma factors often respond to specific stresses:

Growth PhaseOD600Relative β-galactosidase ActivitySampling Time
Early log0.1Low~1 hour
Mid log0.4Moderate~2 hours
Late log0.8Maximum~3 hours
Stationary1.0+Variable>3.5 hours
  • Protein Purification and Analysis: Expressing recombinant yxlC protein with affinity tags to enable purification and subsequent biochemical characterization .

  • Morphological Observation: Since Bacillus subtilis exhibits different morphological stages, observing any changes in cell morphology when yxlC is disrupted can provide functional insights .

For meaningful results, utilize the standard LB medium for Bacillus subtilis culture, which supports optimal growth with a doubling time of approximately 30 minutes during exponential phase under ideal conditions .

How do genetic interactions between yxlC, yxlD, and yxlE contribute to σY regulation?

The genetic interactions within the sigY operon reveal a complex regulatory network affecting σY activity:

  • Autoregulatory Mechanism: The sigY operon is expressed from an autoregulatory promoter site, PY, creating a feedback loop where σY activity influences its own expression and that of downstream genes .

  • Polar Effects Analysis: Experiments with yxlC::Tn10 insertion revealed that the derepression of PY observed was due to polar effects on downstream yxlD and yxlE genes rather than direct yxlC function. This was confirmed by comparing transcriptomes of wild-type and yxlC::Tn10 mutant strains, which showed elevated expression of several operons .

  • Complementation Studies: To conclusively establish the roles of individual genes, complementation experiments are necessary. These should involve introducing each gene (yxlC, yxlD, and yxlE) separately into mutant backgrounds to determine which restores wild-type regulation patterns .

The relationship between these genes suggests a coordinated regulatory system where yxlC may serve as a connecting element between sigY and the direct negative regulators (yxlD and yxlE). This type of arrangement is consistent with other ECF sigma factor systems in Bacillus subtilis, such as those involving σX, σW, and σM, which control functions associated with cell envelope modification and antibiotic response .

What experimental designs are most appropriate for studying regulatory functions of yxlC?

For studying regulatory functions of uncharacterized proteins like yxlC, specific experimental designs offer particular advantages:

When implementing these designs for yxlC studies, include β-galactosidase assays as described in the literature: dilute overnight cultures 1:100 in fresh LB medium, take samples at OD600 values of 0.1, 0.2, 0.4, 0.6, 0.8, 1.0, and 1 hour after reaching 1.0, then measure β-galactosidase activity according to Miller's protocol .

How can transcriptomic analyses be optimized to identify genes regulated by yxlC?

Optimizing transcriptomic analyses for identifying genes regulated by yxlC requires strategic experimental design and analytical approaches:

  • Comparative Transcriptome Analysis:
    The comparison of transcriptomes between wild-type and yxlC mutant strains has already proven valuable, revealing elevated expression of several operons in the yxlC::Tn10 mutant . To enhance this approach:

    • Include multiple mutant types (polar vs. nonpolar)

    • Sample at different growth phases, particularly late log phase (OD600 of 0.8)

    • Include strains with complemented genes to confirm specificity

  • Validation Through Reporter Fusions:
    Genes identified through transcriptomics should be validated using promoter-reporter fusions (e.g., cat-lacZ), similar to the PY-cat-lacZ fusion used to study the sigY promoter . This allows quantitative assessment of expression changes under various conditions.

  • Stress Response Profiling:
    Since ECF sigma factors often respond to specific stresses, exposing cultures to different stressors (antibiotics, pH changes, temperature shifts) while monitoring global gene expression can reveal condition-specific regulatory roles of yxlC. Previous research with σW showed strong induction by alkali shock , suggesting similar approaches for yxlC studies.

  • Time-Course Resolution:
    Rather than single-point measurements, implement time-course transcriptomics to capture the dynamic nature of gene regulation. For optimal results, collect samples at the following intervals:

    Growth PhaseSampling PointsPurpose
    Lag phase2-3 timepointsBaseline expression
    Log phase4-5 timepointsDynamic regulation
    Transition2-3 timepointsRegulatory shifts
    Stationary2-3 timepointsStress adaptation
  • Integration with ChIP-Seq:
    To distinguish direct from indirect regulatory effects, complement transcriptomics with chromatin immunoprecipitation sequencing (ChIP-seq) using tagged yxlC or associated regulatory proteins. This approach can identify direct binding sites and regulatory targets.

  • Analysis of Polar vs. Nonpolar Effects:
    Since research has demonstrated that yxlC::Tn10 insertion phenotypes were due to polarity on downstream genes, carefully design experiments to distinguish direct yxlC effects from downstream regulatory effects . This requires creating and analyzing both polar and nonpolar mutations.

The implementation of these approaches will provide a comprehensive understanding of the regulatory network involving yxlC, potentially revealing its role in the broader context of Bacillus subtilis stress response and cellular adaptation.

What challenges exist in purifying and characterizing the yxlC protein, and how can they be addressed?

Purifying and characterizing uncharacterized proteins like yxlC presents several challenges that require specific methodological approaches:

  • Expression System Selection:
    Challenge: Choosing an appropriate expression system that maintains protein functionality.
    Solution: While E. coli systems are common for recombinant protein expression, maintaining native function may require expression in Bacillus systems. For yxlC, consider using Bacillus subtilis expression vectors with inducible promoters to maintain the native cellular environment . Compare results with commercial recombinant preparations similar to those available for other Bacillus subtilis proteins .

  • Solubility Issues:
    Challenge: Uncharacterized proteins often have unknown solubility properties.
    Solution: Implement a systematic approach testing multiple buffer conditions:

    Buffer TypepH RangeSalt ConcentrationAdditives to Test
    Tris-HCl7.0-8.550-300 mM NaClGlycerol (5-15%)
    Phosphate6.5-8.0100-500 mM NaClDetergents (0.1-1%)
    HEPES7.0-8.050-200 mM NaClReducing agents
  • Functional Assays Development:
    Challenge: Without known function, designing appropriate activity assays is difficult.
    Solution: Based on the genetic evidence that yxlC is linked to σY regulation , design assays that measure:

    • Protein-protein interactions with σY, yxlD, and yxlE proteins

    • DNA-binding capabilities using EMSA (Electrophoretic Mobility Shift Assay)

    • Effects on in vitro transcription using purified Bacillus RNA polymerase and σY

  • Structural Characterization:
    Challenge: Obtaining structural information for novel proteins.
    Solution: Utilize a combination of approaches:

    • Circular dichroism for secondary structure assessment

    • Limited proteolysis to identify domains

    • Crystallization screening or cryo-EM for tertiary structure

    • Comparative modeling based on homologous proteins from other Bacillus species

  • Stability and Storage:
    Challenge: Determining optimal conditions for protein stability.
    Solution: Conduct thermal shift assays to identify stabilizing conditions and additives. For long-term storage, test protein stability in various buffer conditions at -80°C with and without cryoprotectants.

  • Interaction Partner Identification:
    Challenge: Identifying proteins that interact with yxlC.
    Solution: Implement pull-down assays using tagged recombinant yxlC, followed by mass spectrometry to identify interaction partners. Since research indicates relationships between yxlC, yxlD, and yxlE in σY regulation , these proteins would be primary candidates for interaction studies.

By systematically addressing these challenges, researchers can effectively purify and characterize the yxlC protein, providing insights into its molecular function that complement the genetic studies already performed.

How can mutagenesis approaches be optimized for studying yxlC function?

Optimizing mutagenesis approaches for studying yxlC requires strategic implementation of various techniques:

  • Targeted vs. Random Mutagenesis:
    Previous studies successfully used mini-Tn10 transposon mutagenesis to generate random insertions affecting yxlC . For more precise functional analysis:

    • Site-Directed Mutagenesis: Target conserved residues identified through sequence alignment

    • Domain-Specific Mutagenesis: Create truncations or internal deletions to identify functional domains

    • Alanine-Scanning Mutagenesis: Systematically replace charged residues with alanine to identify critical functional sites

  • Selection Strategy Development:
    Research has demonstrated that yxlC mutants can be identified through elevated expression of PY-cat-lacZ, allowing selection on medium containing chloramphenicol and X-Gal . Optimize this approach by:

    • Testing multiple concentrations of chloramphenicol (6, 8, and 10 μg/ml have been effective)

    • Implementing a dual selection system incorporating both antibiotic resistance and visual screening

    • Developing fluorescence-based reporters for high-throughput screening

  • Non-Polar Mutation Generation:
    Since polar effects on downstream genes can confound analysis , implement techniques that minimize polar effects:

    • Use in-frame deletion methodologies rather than insertions

    • Employ marker-less deletion systems

    • Design mutations that preserve operon expression while disrupting only yxlC function

  • Evaluation Protocol Standardization:
    To ensure comparable results across mutants, standardize evaluation protocols:

    Assay TypeStandardization ApproachCritical Parameters
    Growth rateMeasure in LB at 37°C with 1:100 dilutionOD600 readings every 30 min
    Gene expressionβ-galactosidase assay at OD600 = 0.8Three biological replicates
    MorphologyPhase-contrast microscopy at defined timepointsDocument multiple fields
    Stress responseStandardized stress application protocolConsistent timing and concentrations
  • Combinatorial Mutagenesis:
    To understand the relationship between yxlC, yxlD, and yxlE, create:

    • Single gene mutants

    • Double mutants in all combinations

    • Triple mutants

    This approach has proven valuable, as demonstrated by the generation of a sigY yxlC double mutant (HB0121) to study regulatory interactions .

  • Recovery and Verification:
    Ensure mutant verification through:

    • Sequence confirmation of mutations

    • Complementation studies

    • RT-PCR to verify expression of downstream genes (critical for distinguishing polar from direct effects)

By implementing these optimized mutagenesis approaches, researchers can systematically explore yxlC function while distinguishing direct effects from those caused by disruption of the broader sigY operon structure.

What considerations are important when designing experiments to study yxlC's role in stress response pathways?

When investigating yxlC's potential role in stress response pathways, several experimental design considerations become critical:

  • Stress Condition Selection Based on ECF Sigma Factor Knowledge:
    Since yxlC is associated with the sigY operon and ECF sigma factors, selecting relevant stressors is crucial. Other ECF sigma factors in Bacillus subtilis respond to specific stresses:

    • σX: Cell envelope modifications

    • σW and σM: Antibiotics targeting cell envelope

    • σW: Strongly induced by alkali shock

    Design experiments testing multiple stress conditions including:

    • Cell wall-targeting antibiotics (various concentrations)

    • pH challenges (particularly alkaline stress)

    • Osmotic pressure variations

    • Oxidative stress agents

    • Temperature shifts

  • Multi-Level Analysis Approach:
    Integrate measurements at different biological levels:

    LevelMeasurement TechniqueWhat It Reveals
    TranscriptionalRT-qPCR, RNA-seqGene expression changes
    TranslationalWestern blot, proteomicsProtein abundance changes
    Post-translationalPhosphoproteomicsRegulatory modifications
    PhenotypicGrowth curves, survival assaysFunctional outcomes
  • Genetic Background Considerations:
    Test multiple genetic backgrounds to identify specific yxlC contributions:

    • Wild-type

    • yxlC nonpolar mutant

    • yxlC polar mutant affecting downstream genes

    • yxlD and yxlE mutants

    • Various combinations of multiple mutations

  • Experimental Controls:
    Include appropriate controls for stress response studies:

    • Non-stressed cultures sampled at identical timepoints

    • Stress-resistant mutants as positive controls

    • Known stress-sensitive mutants as benchmarks

    • Complemented strains to confirm phenotype specificity

  • Integration with σY Activity Measurements:
    Since yxlC appears involved in σY regulation , correlate stress responses with σY activity using:

    • PY-cat-lacZ reporter fusion expression measurements

    • Direct measurement of σY protein levels

    • Analysis of known or putative σY-dependent promoters

This comprehensive approach will help elucidate the specific role of yxlC in stress response pathways while distinguishing its contributions from those of other components in the sigY operon regulatory network.

How can structural predictions inform functional hypotheses about yxlC protein?

In the absence of experimental structural data, computational approaches can generate valuable functional hypotheses about uncharacterized proteins like yxlC:

  • Sequence-Based Structure Prediction:
    Implement multiple prediction algorithms to build consensus models:

    • AlphaFold or RoseTTAFold for ab initio prediction

    • SWISS-MODEL or Phyre2 for homology modeling

    • PSIPRED for secondary structure prediction

    • TMHMM for transmembrane domain prediction

    The reliability of predictions can be assessed through confidence scores provided by these tools. Higher confidence regions should be prioritized for functional hypothesis development.

  • Domain Architecture Analysis:
    Identify potential functional domains through:

    • InterProScan for known domain detection

    • Conserved Domain Database (CDD) searches

    • Analysis of hydrophobic clusters

    • Disorder prediction to identify flexible regions

    Since yxlC functions within the context of σY regulation , look specifically for domains associated with:

    • Protein-protein interaction interfaces

    • DNA-binding motifs

    • Signal-sensing domains

    • Regulatory domains

  • Structure-Function Correlation:
    Use predicted structures to inform experimental design:

    Structural FeatureFunctional HypothesisExperimental Validation Approach
    Surface pocketsPotential binding sitesSite-directed mutagenesis
    Conserved surface patchesInteraction interfacesPull-down assays
    DNA-binding motifsTranscriptional regulationEMSA assays
    Signal-sensing domainsStress response roleStress exposure experiments
  • Evolutionary Conservation Mapping:
    Analyze sequence conservation across multiple Bacillus species:

    • Generate multiple sequence alignments

    • Map conservation scores onto predicted structures

    • Identify highly conserved residues as functionally important

    • Look for co-evolution patterns with yxlD and yxlE proteins

  • Molecular Dynamics Simulations:
    For high-confidence structural models:

    • Simulate protein behavior in different environments

    • Assess conformational flexibility

    • Identify potential allosteric sites

    • Evaluate stability under different conditions

  • Integration with Experimental Data:
    Connect structural predictions with existing experimental findings:

    • Map locations of disruptive mutations from transposon studies

    • Predict effects of these mutations on protein structure

    • Design targeted mutations at predicted functional sites

    • Develop structure-based hypotheses for the relationship between yxlC, yxlD, and yxlE

By systematically applying these computational approaches, researchers can develop testable hypotheses about yxlC function based on predicted structural features, guiding subsequent experimental investigations more efficiently.

What statistical approaches are most appropriate for analyzing experimental data from yxlC studies?

Selecting appropriate statistical approaches for yxlC studies depends on experimental design and data characteristics:

  • Time-Series Data Analysis:
    For studies tracking yxlC expression or activity over time:

    • Interrupted time series analysis for detecting intervention effects

    • Autocorrelation correction methods to account for non-independence

    • Growth curve fitting using parametric models

    • Time-series ANOVA for comparing different strains or conditions

    Example application: Analysis of β-galactosidase activity measured at different growth phases (OD600 values of 0.1, 0.2, 0.4, 0.6, 0.8, 1.0) .

  • Comparative Expression Analysis:
    For comparing expression levels between wild-type and mutant strains:

    • Two-way ANOVA incorporating both strain and condition factors

    • Post-hoc tests with appropriate correction for multiple comparisons

    • Fold-change calculations with confidence intervals

    • Nonparametric alternatives (Mann-Whitney U test) for non-normally distributed data

  • Transcriptomic Data Analysis:
    For genome-wide expression studies:

    • Differential expression analysis with appropriate normalization

    • False discovery rate control for multiple testing

    • Gene set enrichment analysis to identify affected pathways

    • Clustering methods to identify co-regulated genes

  • Regression-Discontinuity Analysis:
    Particularly valuable for:

    • Detecting threshold effects in regulation

    • Analyzing dose-response relationships

    • Identifying critical timepoints in regulatory cascades

    This approach is well-suited for analyzing the sigY regulatory system, where transitions between regulatory states may occur at specific thresholds.

  • Design-Specific Statistical Approaches:
    Match statistical methods to experimental designs:

    Experimental DesignAppropriate Statistical ApproachApplication in yxlC Research
    Pre-test/Post-test Control GroupANCOVA with pretest as covariateComparing stress response in different strains
    Equivalent Materials DesignNested ANOVAAnalyzing effects of different yxlC mutations
    Multiple Time-SeriesMixed-effects modelsTracking expression across growth phases
    Factorial DesignsMulti-way ANOVA with interaction termsAssessing combined effects of mutations and stressors
  • Power Analysis and Sample Size Calculation:
    Ensure adequate statistical power by:

    • Determining minimum sample sizes needed

    • Using preliminary data to estimate effect sizes

    • Accounting for biological and technical replication

    • Considering variability observed in previous studies

    For β-galactosidase assays, previous studies used three individual colonies with statistical significance achieved , providing a baseline for sample size determination.

  • Bayesian Approaches:
    Consider Bayesian statistics for:

    • Incorporating prior knowledge from related ECF sigma factor studies

    • Handling small sample sizes more effectively

    • Quantifying uncertainty in complex models

    • Comparing competing mechanistic models of yxlC function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.