Recombinant Bacillus subtilis Uncharacterized protein yxxB (yxxB)

Shipped with Ice Packs
In Stock

Description

3.1. Role in B. subtilis

While yxxB remains uncharacterized, its genomic context in B. subtilis strain 168 suggests involvement in cellular processes common to hypothetical proteins, such as structural maintenance or stress response .

3.2. Recombinant Production Challenges

  • Secretion pathways: B. subtilis employs Sec/Tat systems for protein export , but YxxB’s lack of a signal peptide implies cytoplasmic retention unless engineered for secretion.

  • Protease susceptibility: Native extracellular proteases in B. subtilis often degrade recombinant proteins, necessitating protease-deficient strains for optimal yield .

3.3. Applications

  • Antigen development: Hypothetical proteins like YxxB are frequently used to study immune responses in pathogenic relatives (e.g., Bacillus anthracis) .

  • Structural studies: Purified YxxB enables crystallography or NMR to resolve its tertiary structure and functional motifs.

Comparative Analysis of Related Proteins

ProteinUniProt IDLength (aa)Expression HostTagKey Feature
YphBP50742297E. coliHis-tagUncharacterized, full-length
YhgBN/AN/AE. coliHis-tagUndisclosed function
YuaBN/AN/AE. coliNoneMembrane-associated

Future Research Directions

  1. Functional annotation: CRISPR-Cas9 knockout studies to identify phenotypic changes in yxxB-deficient B. subtilis.

  2. Interaction profiling: Yeast two-hybrid screens to map binding partners.

  3. Industrial optimization: Leveraging B. subtilis’ GRAS status for scalable YxxB production via promoter engineering (e.g., Pgrac or PxylA) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yxxB; LP6B; BSU39440; Uncharacterized protein YxxB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxxB
Target Protein Sequence
MAVKDRYMSKIKQETKPWIKRFGRLGYFAFGGVFILLGVLAFMTAAGAGRAKDSSGALQT LSRMPYGSLLLFFIGIGLIGYVIWMVLSAIKDTEGHGNSRRGLSRRIGNFFSAAVYTSIA WNALRFVFGQGDGGTSEQTWSAYVLAQPFGQWLTGLTGAGFIVFAIVQFMKGVRAAFMKE FDTSKMNKQMICITKNTGRAGNIARAIIFSAIGYFLIKTAMTADPDDTRGFDGALAELAQ QPHGKLILSILALGLILYGMYAIMKGIYQHMTWEK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches should be used for initial characterization of recombinant yxxB protein?

Initial characterization of recombinant yxxB should follow a systematic approach:

  • Expression and Purification Verification: Confirm successful expression and purification using SDS-PAGE and Western blotting with anti-His antibodies to verify the correct molecular weight and purity (>80% as standard) .

  • Protein Stability Assessment: Evaluate protein stability under different buffer conditions and temperatures to establish optimal handling parameters. This is critical as the storage recommendations (PBS buffer at -20°C to -80°C) provide only general guidance .

  • Basic Biochemical Characterization: Determine fundamental properties including:

    • Secondary structure composition using circular dichroism

    • Thermal stability via differential scanning fluorimetry

    • Oligomerization state through size exclusion chromatography

  • Preliminary Functional Assays: Based on bioinformatic predictions, design initial functional assays to test potential activities such as:

    • DNA/RNA binding capabilities

    • Enzymatic activities

    • Protein-protein interactions with known B. subtilis proteins

Similar approaches have been successfully applied to other uncharacterized proteins in B. subtilis, such as YlxR, which was subsequently identified as an RNA-binding protein that interacts with RNase P .

How should researchers approach the expression and purification of yxxB for laboratory studies?

The expression and purification of recombinant yxxB requires specific methodological considerations:

Expression System Selection:

  • E. coli systems (typically BL21(DE3) or derivatives) are recommended for initial expression trials due to simplicity and yield .

  • For proteins requiring post-translational modifications or proper folding, yeast expression systems may be preferable .

  • Consider testing multiple expression constructs with different fusion tags (N-terminal vs. C-terminal His-tag) to optimize solubility and yield.

Optimized Purification Protocol:

  • Lysis Optimization: Use buffer conditions that maintain protein stability while effectively disrupting host cells (typically phosphate buffers with mild detergents for initial trials).

  • IMAC Purification: Employ immobilized metal affinity chromatography using Ni-NTA or Co-NTA resins for His-tagged yxxB purification. Include stepwise imidazole gradients (10-250 mM) to minimize non-specific binding.

  • Secondary Purification: Apply size exclusion chromatography or ion exchange chromatography as needed to achieve >80% purity as verified by SDS-PAGE .

  • Quality Control: Conduct dynamic light scattering to assess homogeneity and absence of aggregation before proceeding to functional studies.

  • Endotoxin Removal: If intended for cellular assays, ensure endotoxin levels are below 1.0 EU per μg of protein using appropriate removal techniques and LAL testing .

What bioinformatic approaches can predict potential functions of yxxB?

Advanced bioinformatic analysis of yxxB should employ multiple complementary approaches:

Sequence-Based Analysis:

  • Homology Detection: Beyond standard BLAST searches, employ position-specific iterative BLAST (PSI-BLAST) and hidden Markov model-based tools like HMMER to identify distant homologs with known functions.

  • Domain Prediction: Utilize InterProScan, SMART, and Pfam databases to identify conserved domains that might suggest function.

  • Motif Analysis: Search for functional motifs using PROSITE, ELM, and ScanProsite to identify specific sequence patterns associated with known activities.

Structural Bioinformatics:

  • Secondary Structure Prediction: Apply tools like PSIPRED and JPred to predict secondary structure elements.

  • Tertiary Structure Modeling: Generate 3D structural models using AlphaFold2 or I-TASSER, followed by structural comparison against known protein structures using DALI or TM-align.

  • Binding Site Prediction: Identify potential ligand binding sites using CASTp or COACH to suggest possible interaction partners.

Systems Biology Integration:

  • Co-expression Analysis: Analyze transcriptomic data to identify genes co-expressed with yxxB under various conditions, potentially indicating functional relationships similar to methods used in large-scale B. subtilis studies .

  • Regulatory Network Integration: Position yxxB within the known B. subtilis regulatory network, noting that recent studies have predicted 2,258 novel regulatory interactions in B. subtilis .

  • Phylogenetic Profiling: Examine the presence/absence pattern of yxxB across bacterial species to identify functional associations.

A table summarizing the potential functions predicted by different methods would provide valuable direction for subsequent experimental validation:

Analysis MethodPredictionConfidence ScoreSuggested Experimental Validation
Domain analysisDNA/RNA bindingMediumEMSA, RNA-seq following knockout
Structural homologyMetabolic enzymeLowActivity assays with predicted substrates
Co-expressionStress responseHighGene expression under stress conditions
Regulatory networkRegulated by transcription factor XMediumChIP-seq, reporter assays

How can transcriptomic and proteomic data be leveraged to understand the role of yxxB?

Integrating high-throughput data for functional characterization requires sophisticated analytical approaches:

Transcriptomic Analysis:

  • Differential Expression Studies: Compare wild-type and yxxB knockout strains under multiple conditions (similar to the extensive B. subtilis transcriptional profiling done for other genes, with samples collected at regular intervals) .

  • Time-Series Analysis: Conduct time-series experiments during key processes like germination, stress responses, and sporulation, which have proven informative in B. subtilis studies .

  • Network Component Analysis (NCA): Apply NCA as was successfully done for the B. subtilis global transcriptional regulatory network to identify potential regulatory relationships .

Proteomic Approaches:

  • Interaction Proteomics: Employ affinity purification coupled with mass spectrometry (AP-MS) to identify proteins that physically interact with yxxB.

  • Protein Expression Profiling: Compare proteome changes in yxxB knockout vs. wild-type strains to identify pathways affected by yxxB absence.

  • Post-translational Modification Analysis: Investigate whether yxxB undergoes or affects post-translational modifications by phosphoproteomics or other PTM-specific analyses.

Integration Strategies:

  • Multi-omics Data Integration: Combine transcriptomic, proteomic, and metabolomic data to position yxxB in cellular pathways.

  • Network Inference: Utilize algorithms like those used in the comprehensive B. subtilis regulatory network study to infer functional relationships .

  • Validation Experiments: Design targeted experiments to confirm predicted interactions, similar to how 391 out of 635 novel regulatory edges were experimentally validated in previous B. subtilis studies .

What experimental design considerations are critical for knockout studies of yxxB?

Knockout studies require careful planning to generate meaningful data:

Knockout Strategy Selection:

  • Clean Deletion vs. Insertion Inactivation: Consider creating a markerless clean deletion to avoid polar effects on downstream genes, particularly important if yxxB is part of an operon.

  • Conditional Knockout: If yxxB might be essential, design conditional expression systems using inducible promoters or degron tags.

  • CRISPR-Cas9 Approaches: Utilize CRISPR-Cas9 for precise genome editing, which has been successfully adapted for B. subtilis.

Control Considerations:

  • Complementation Controls: Include a complementation strain where the wild-type yxxB is reintroduced to verify phenotypes are specifically due to yxxB deletion.

  • Multiple Strain Backgrounds: Test the knockout in different B. subtilis strains (e.g., 168, PY79, BSB1) as strain-specific effects have been observed in previous studies .

  • Marker Effect Controls: Include controls for any selection markers used to ensure observed phenotypes aren't due to marker expression.

Phenotypic Analysis:

  • Comprehensive Phenotyping: Examine:

    • Growth under various conditions (temperature, pH, nutrients, stressors)

    • Morphological changes

    • Sporulation efficiency

    • Competence development

    • Biofilm formation

  • High-Resolution Growth Analysis: Monitor growth with high temporal resolution similar to the approaches used in the HtrA protease studies, measuring OD600 every 10 minutes to capture subtle growth defects .

  • Stress Response Assessment: Specifically test responses to various stresses, as many uncharacterized proteins are involved in stress adaptation.

Data Collection Timeline:
Sample collection should occur at multiple timepoints (3h, 6h, 18h) during growth phases as exemplified in the HtrA studies to capture temporal effects .

How can protein-protein interaction studies help elucidate the function of yxxB?

Protein interaction studies provide critical insights into protein function:

In Vitro Interaction Methods:

  • Pull-down Assays: Use purified His-tagged yxxB as bait to identify interacting partners from B. subtilis lysates, followed by mass spectrometry identification.

  • Surface Plasmon Resonance: Measure binding kinetics and affinities between yxxB and candidate interacting proteins.

  • Isothermal Titration Calorimetry: Characterize thermodynamic parameters of protein-protein interactions to assess specificity.

In Vivo Interaction Approaches:

  • Bacterial Two-Hybrid: Screen for interactions using bacterial two-hybrid systems adapted for B. subtilis.

  • Fluorescence Resonance Energy Transfer (FRET): Engineer fluorescent protein fusions to study interactions in living cells.

  • Proximity-Dependent Biotin Identification (BioID): Identify proteins in close proximity to yxxB in vivo.

Network Analysis:

  • Interaction Network Visualization: Map identified interactions into the existing B. subtilis protein interaction network.

  • Functional Clustering: Identify functional clusters among interacting proteins to infer yxxB function.

  • Evolutionary Conservation Analysis: Assess conservation of interactions across bacterial species to determine core functional relationships.

Similar approaches successfully identified the RNA subunit of RNase P as a binding partner of the previously uncharacterized YlxR protein, revealing its function in RNA processing .

How should researchers interpret contradictory experimental results about yxxB?

When facing contradictory results, implement a systematic approach to reconciliation:

Methodological Reconciliation:

  • Experimental Conditions Audit: Carefully compare all experimental conditions between contradictory studies, including:

    • Strain backgrounds (PY79 vs. 168 vs. BSB1) which have been shown to affect results in B. subtilis studies

    • Growth media composition

    • Growth phase at sampling

    • Expression constructs and tags

  • Technical Variation Assessment: Evaluate whether differences stem from:

    • Sensitivity limits of detection methods

    • Batch effects in reagents or equipment

    • Sampling time variations

  • Statistical Reanalysis: Apply consistent statistical methods across datasets to determine if contradictions remain after standardized analysis.

Biological Explanations:

  • Context-Dependent Function: Consider whether yxxB may have different functions under different conditions, as seen with dual-function proteins like HtrA which exhibits both protease and chaperone activities .

  • Indirect vs. Direct Effects: Distinguish between primary (direct) effects of yxxB and secondary consequences through regulatory networks.

  • Genetic Background Effects: Analyze whether contradictions correlate with differences in strain backgrounds, as B. subtilis strains can vary significantly despite being derivatives of strain 168 .

Resolution Strategies:

  • Decisive Experiment Design: Design experiments specifically targeted at resolving contradictions, with appropriate controls.

  • Independent Validation: Seek validation from orthogonal methods to confirm findings.

  • Meta-analysis Approach: Integrate all available data through formal meta-analysis techniques to identify consensus findings and outliers.

What methodological considerations are important for designing structure-function studies of yxxB?

Structure-function studies require careful methodological planning:

Structural Analysis Approaches:

  • X-ray Crystallography Preparation: Optimize conditions for crystal formation including:

    • Protein concentration (typically 5-20 mg/mL)

    • Buffer composition and pH screening

    • Precipitant type and concentration

    • Additive screening

  • NMR Spectroscopy Considerations:

    • Isotopic labeling strategies (15N, 13C, 2H)

    • Sample concentration and stability over extended measurement times

    • Temperature optimization for signal quality

  • Cryo-EM Sample Preparation:

    • Grid type selection and optimization

    • Vitrification conditions

    • Particle concentration adjustment

Functional Validation Methods:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues identified by sequence analysis

    • Design alanine scanning of predicted functional sites

    • Create domain truncations to map functional regions

  • Activity Assay Development:

    • Design assays based on structural homology predictions

    • Include appropriate positive and negative controls

    • Validate assay robustness with known-function homologs

  • In vivo Functional Complementation:

    • Test whether mutant versions can complement knockout phenotypes

    • Quantify degree of complementation for structure-function correlations

    • Use inducible expression systems to titrate protein levels

Data Integration Framework:

  • Structure-Guided Hypothesis Generation:

    • Map conservation patterns onto structural models

    • Identify potential binding pockets or catalytic sites

    • Compare with structural homologs of known function

  • Iterative Refinement Process:

    • Use initial functional data to refine structural studies

    • Guide additional mutational analysis based on structural insights

    • Develop integrated models of structure-function relationships

How might yxxB be integrated into synthetic biology applications in B. subtilis?

Engineering applications require understanding potential integration points:

Synthetic Circuit Design:

  • Regulatory Element Utilization: If yxxB has regulatory functions, its promoter or binding sites could be incorporated into synthetic gene circuits.

  • Protein Scaffolding Applications: Should yxxB function as a scaffold protein, it could be engineered to co-localize enzymes in metabolic pathways.

  • Biosensor Development: If yxxB responds to specific cellular conditions, it could be adapted as a biosensor component.

Production Optimization:

  • Recombinant Protein Expression Enhancement: If yxxB affects protein folding or secretion, it could be co-expressed with recombinant proteins to improve yields, similar to how proteolytically inactive HtrA enhances recombinant enzyme production .

  • Strain Engineering Targets: Consider whether yxxB modification could improve B. subtilis properties as a cell factory, potentially enhancing bacterial fitness as observed with engineered HtrA variants .

  • Secretion Stress Response Modulation: Investigate whether yxxB participates in secretion stress responses, which are critical during high-level production of secreted proteins .

Experimental Design Considerations:

  • Expression Level Optimization: Titrate yxxB expression using inducible promoters and monitor effects on target applications.

  • Fusion Protein Strategy: Design fusion proteins combining yxxB with functional domains for specific applications.

  • Genome Integration Approach: For stable expression, integrate modified yxxB variants into the chromosome rather than using plasmid-based expression.

What considerations are important when analyzing high-throughput data related to yxxB function?

High-throughput data analysis requires specialized approaches:

Experimental Design for High-Throughput Studies:

  • Replicate Planning: Include sufficient biological replicates (minimum n=3) and technical replicates to enable robust statistical analysis.

  • Control Selection: Incorporate appropriate positive and negative controls, including wild-type, knockout, and complemented strains.

  • Condition Selection: Design experimental conditions to capture diverse cellular states, similar to the comprehensive approach used in B. subtilis transcriptomic studies with 38 separate experimental designs .

Data Analysis Workflow:

  • Quality Control Procedures:

    • Raw data assessment (sequence quality, signal-to-noise ratio)

    • Batch effect identification and correction

    • Outlier detection and handling

  • Normalization Methods:

    • Select appropriate normalization based on data type

    • Compare results from multiple normalization approaches

    • Validate normalization by examining control genes/proteins

  • Statistical Analysis Framework:

    • Apply multiple testing correction for high-dimensional data

    • Consider both parametric and non-parametric approaches

    • Implement appropriate cut-offs for significance

Biological Interpretation:

  • Enrichment Analysis: Apply Gene Ontology, KEGG pathway, or custom B. subtilis-specific functional category enrichment.

  • Network Analysis: Position findings within known B. subtilis regulatory networks .

  • Cross-Platform Integration: Integrate results across multiple omics platforms for comprehensive biological insights.

By following these methodological guidelines and leveraging the approaches that have been successful in characterizing other B. subtilis proteins, researchers can make significant progress in understanding the function of the currently uncharacterized yxxB protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.