Recombinant Bacillus subtilis Uncharacterized protein yyaP (yyaP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
yyaP; BSU40760; Uncharacterized protein YyaP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yyaP
Target Protein Sequence
MTNNLKQRRIILDLAVTLDGFIEGKNGEVDWCIMDPDMGFTDFLNQIDTILYGRKSFDLW GQYIPKNEDPDTEKELWKLVHSKKKYVFSRTQNEIDNQAIFINDNILEEVNKLKKNPGKD IWLYGGASLITTFINLGLVDEFRLSIHPVVLGEGKPLFIDVKQRINLKMVNTRTFSSGVV QIVYHWNG
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the current state of knowledge about the uncharacterized protein YyaP in Bacillus subtilis?

YyaP (gene designation: yyaP) is an uncharacterized protein in Bacillus subtilis with limited functional annotation. As part of the ongoing characterization efforts of the B. subtilis proteome, researchers are investigating its potential roles in cellular processes. Current studies leverage comparative genomics, structural prediction, and expression analysis to elucidate its function. While specific information about YyaP is limited in the literature, methodologies employed for uncharacterized protein characterization in B. subtilis include secretion tag screening, genomic integration, and expression optimization under various conditions. Researchers typically begin with sequence analysis to identify conserved domains, potential secretion signals, and transmembrane regions before proceeding to experimental characterization .

Why is Bacillus subtilis preferred as an expression system for recombinant proteins like YyaP?

Bacillus subtilis has emerged as a preferred microbial chassis for recombinant protein production due to several advantageous characteristics:

  • Natural secretory capacity: B. subtilis can efficiently secrete proteins into the extracellular medium, significantly simplifying downstream purification processes.

  • Space-hardy characteristics: B. subtilis endospores have demonstrated remarkable survival in extreme conditions, including space environments, making them ideal for specialized applications.

  • GRAS (Generally Recognized As Safe) status: Unlike E. coli, B. subtilis lacks endotoxins, making it suitable for pharmaceutical protein production.

  • Robust genetic manipulation tools: Advanced genome-editing technologies, including CRISPR-Cas9, have been successfully applied to B. subtilis.

  • Long-term stability: The organism can form endospores that remain viable for extended periods (surviving in space vacuum for nearly 6 years), enabling convenient storage as dehydrated spores at room temperature .

These characteristics make B. subtilis particularly valuable for expressing difficult-to-characterize proteins like YyaP, especially when secretion into the culture medium is desired for easier isolation and functional studies .

What genetic tools are available for manipulating yyaP in B. subtilis?

Several genetic manipulation approaches are available for studying yyaP in B. subtilis:

Genetic ToolApplication for yyaP ResearchTechnical Considerations
CRISPR-Cas9 systemPrecise genome editing, knockout generation, promoter modificationRequires PAM site identification, potential off-target effects need validation
Genomic integrationStable single-copy expression at defined loci (e.g., amyE locus)Integration verification needed; potential for frameshift mutations during integration
Secretion tag librariesTesting various native signal peptides for optimal YyaP secretionRequires screening with multiple secretion peptides as different proteins respond differently to secretion signals
Inducible expression systemsControlled expression for toxic/challenging proteinsOptions include IPTG, xylose, or mannose-inducible systems
Reporter fusionsMonitoring expression/localization (HiBiT tags, fluorescent proteins)May affect protein folding or function

For uncharacterized proteins like YyaP, researchers must typically try multiple approaches, as demonstrated in similar studies where genomic integration attempts faced challenges with frameshift mutations until optimized PCR amplification and linearization methods were employed .

What are the optimal conditions for expressing recombinant YyaP in B. subtilis?

Determining optimal expression conditions for recombinant YyaP in B. subtilis requires systematic testing of multiple parameters:

ParameterOptimization StrategyNotes from Related Protein Expression
TemperatureTest range from 15°C to 40°C in 5°C incrementsData from other B. subtilis recombinant proteins shows highest secretion at 25°C despite optimal growth at 35-40°C
Growth phaseMonitor expression from early log to stationary phaseLate log phase often optimal for secreted protein production
Media compositionCompare minimal vs. rich media; supplement with various carbon sourcesComplex media may increase biomass but dilute target protein
Promoter selectionTest constitutive vs. inducible promoters (Pveg, P43, Pxyl)Stronger promoters don't always yield higher secretion levels
Secretion tagScreen multiple native secretion peptides (walM, yoqH, aprE, sacB)Different proteins respond optimally to different signal peptides

For example, research with other B. subtilis recombinant proteins demonstrated that maximum secretion occurred at 25°C despite cell density being highest at 40°C, indicating important trade-offs between growth and secretion efficiency . When expressing an uncharacterized protein like YyaP, it's advisable to employ a factorial experimental design to systematically evaluate these parameters in combination.

What secretion signal peptides should be tested for optimal YyaP secretion?

When optimizing YyaP secretion, researchers should test multiple signal peptides as secretion efficiency is highly protein-specific. Based on experience with other recombinant proteins in B. subtilis, consider the following approach:

  • Create a library testing multiple secretion peptides fused to YyaP

  • Include these high-performing signal peptides based on results from similar proteins:

    • walM signal peptide (performed well for teriparatide secretion)

    • yoqH signal peptide (showed superior performance for filgrastim secretion)

    • aprE signal peptide (commonly used baseline control)

    • phrG, sacC, yncM, and ypuA signal peptides (demonstrated high performance in screening)

  • Implement a high-throughput screening method using reporter tags (e.g., HiBiT) to quantify secretion levels

  • Perform multiple rounds of screening to confirm consistent performance

  • Sequence top candidates to identify the optimal secretion peptide

Recent research demonstrated that the relationship between secretion tag choice and protein type is poorly understood, and a single tag cannot reliably secrete different heterologous proteins. For instance, the walM secretion peptide outperformed others for teriparatide, while yoqH was superior for filgrastim - showing improvements of 10-fold and 5-fold respectively over the standard aprE signal peptide .

How can I overcome common challenges in genomic integration of yyaP constructs?

Genomic integration of yyaP constructs in B. subtilis may encounter several challenges, particularly frameshift mutations and premature stop codons. Based on similar recombinant protein integration experiences, researchers should:

  • Skip intermediate cloning steps and directly use PCR amplification with high-fidelity polymerase followed by linearization of the construct for transformation

  • Target stable integration loci such as the amyE locus, which accepts foreign DNA without disrupting essential processes

  • Screen multiple transformants (>40 colonies recommended) and perform comprehensive sequencing to identify intact integrants

  • Consider alternative integration methods if persistent mutations occur:

    • Use counter-selection markers

    • Employ CRISPR-Cas9 for precise integration

    • Test different integration loci (lacA, thrC) if amyE proves problematic

  • Retain negative control strains with frameshift mutations for experimental comparisons

Research with similar protein constructs revealed that standard genomic integration methods frequently resulted in frameshift mutations and premature stop codons in all tested colonies. Success was achieved only after eliminating intermediate cloning steps and proceeding directly to PCR amplification and linearization of the construct for transformation .

What methods should be employed for initial characterization of YyaP function?

For initial characterization of the uncharacterized YyaP protein, employ a systematic multi-pronged approach:

Characterization MethodApplicationExperimental Design Considerations
Bioinformatic analysisIdentify conserved domains, potential interactions, structural predictionsUtilize tools like Pfam, BLAST, AlphaFold; search for orthologs in related species
Gene knockout studiesAssess phenotypic changes from yyaP deletionUse CRISPR-Cas9 for clean deletions; examine growth curves, stress responses
Conditional expressionControl YyaP levels to observe dose-dependent effectsEmploy inducible promoters with varying inducer concentrations
Protein localizationDetermine subcellular distributionFluorescent protein fusions or immunofluorescence; confirm tags don't disrupt function
Interactome analysisIdentify protein-protein interaction partnersConsider affinity purification with mass spectrometry approaches similar to YAP/TAZ studies
Transcriptional profilingAssess gene expression changes upon YyaP modulationRNA-seq comparing wild-type, deletion, and overexpression strains

When characterizing uncharacterized proteins, it's crucial to integrate multiple lines of evidence. For example, the study of YAP/TAZ interactomes combined Flp-in cellular integration systems with affinity purification and mass spectrometry to reveal previously uncharacterized interaction partners that affected downstream transcription . Similar approaches could reveal YyaP's functional network.

How can I optimize YyaP purification from B. subtilis culture supernatants?

Optimizing YyaP purification from B. subtilis culture supernatants requires consideration of specific protein properties and secretion efficiency:

  • Preliminary analysis:

    • Determine theoretical properties (molecular weight, pI, hydrophobicity)

    • Test small-scale expression with different secretion tags

    • Verify secretion using Western blot or reporter assays

  • Purification strategy development:

    • Concentrate supernatant via tangential flow filtration or ammonium sulfate precipitation

    • Select initial capture method based on protein properties:

      • IMAC chromatography (requires His-tag fusion)

      • Ion exchange chromatography (based on predicted pI)

      • Hydrophobic interaction chromatography

    • Employ polishing steps (size exclusion chromatography)

  • Optimization factors:

    • Culture harvest timing (typically late logarithmic phase)

    • Protease inhibitor cocktail addition

    • Temperature control during purification

    • Buffer composition optimization

The advantage of using B. subtilis is that its robust secretory system eliminates the need for cell lysis, significantly simplifying purification processes. Research has shown that properly designed secretion constructs can release the target protein directly into the culture medium, allowing for simpler downstream processing compared to intracellular expression systems .

How can I resolve contradictory data when characterizing YyaP function?

When faced with contradictory data during YyaP characterization, implement this systematic resolution framework:

  • Evaluate experimental variables:

    • Compare strain backgrounds (168, W168, PY79) as different B. subtilis lineages may show phenotypic variations

    • Review expression conditions (temperature, media, growth phase) as these significantly impact protein behavior

    • Assess tagging strategies as tags may affect protein function differently

  • Perform orthogonal validation:

    • Confirm findings using complementary methodologies

    • Conduct genetic complementation studies

    • Utilize different secretion/purification strategies

  • Consider physiological context:

    • Test function under various stress conditions

    • Examine growth phase-dependent effects

    • Investigate potential redundancy with other proteins

  • Analyze protein variants:

    • Generate targeted mutations in conserved domains

    • Test truncated versions to identify functional regions

    • Compare orthologs from related Bacillus species

  • Implement quantitative approaches:

    • Use statistical methods to determine significance of contradictory results

    • Employ dose-response experiments to detect threshold effects

    • Consider kinetic studies rather than endpoint measurements

When working with uncharacterized proteins like YyaP, contradictions often emerge from subtle experimental differences or incomplete understanding of the protein's regulation. For example, research with other B. subtilis proteins has shown that temperature significantly affects secretion efficiency independently of growth rate, highlighting the importance of controlling multiple parameters simultaneously .

How might YyaP be utilized in astropharmacy applications?

The potential application of YyaP in astropharmacy would depend on its characterized function, but following the established framework for B. subtilis protein production in space:

  • Stability assessment:

    • Test YyaP expression construct stability in simulated space conditions

    • Evaluate spore survival under radiation and vacuum exposure

    • Determine shelf-life of dried spores containing YyaP expression constructs

  • Production efficiency:

    • Optimize culture conditions in simulated microgravity

    • Determine minimum culture volume needed for therapeutic dose production

    • Engineer high-efficiency secretion using optimal signal peptides

  • Processing considerations:

    • Develop simplified purification protocols feasible in space habitats

    • Design low-mass, reusable purification systems

    • Validate stability of purified YyaP under space conditions

The concept of astropharmacy demonstrates how B. subtilis can be engineered to produce therapeutic proteins in space using minimal resources. Research has shown that engineered B. subtilis strains can secrete therapeutic peptides like teriparatide and filgrastim, producing therapeutic dose equivalents in 24-hour culture periods from dried spores. Similar approaches could be applied to YyaP if it demonstrates therapeutic potential .

What are the key experimental controls needed when studying YyaP expression?

When designing rigorous experiments for YyaP characterization, include these essential controls:

Control TypePurposeImplementation
Negative genomic integration controlValidate phenotypic effectsUse strain with frameshift mutation in the yyaP construct (e.g., premature stop codon in signal peptide)
Empty vector controlAccount for expression system effectsTransform with backbone vector lacking yyaP insert
Secretion tag baselineEstablish secretion efficiency benchmarkInclude aprE signal peptide fusion as standard comparator
Wild-type B. subtilisEstablish baseline phenotypeUse parental strain (same background as expression strain)
Alternative protein controlDifferentiate general vs. specific effectsExpress well-characterized protein using identical methods
Growth condition controlsAccount for environmental variablesTest multiple temperatures (15-40°C range), media compositions
Time-course samplingCapture dynamic expression patternsMeasure YyaP levels at regular intervals (e.g., 4h, 8h, 16h, 24h)

Research with teriparatide and filgrastim expression in B. subtilis demonstrated the importance of these controls, particularly using strains with premature stop codons as negative controls and systematically testing temperature effects on expression. The secretion of teriparatide was highest at 25°C despite optimal growth occurring at 35-40°C, highlighting the need for comprehensive control conditions .

How can high-throughput approaches accelerate YyaP characterization?

Implementing high-throughput approaches can significantly accelerate YyaP characterization through parallel analysis of multiple parameters:

  • Secretion tag screening:

    • Construct a comprehensive library of YyaP fused to various B. subtilis secretion tags

    • Implement reporter systems (HiBiT tags) for rapid luminescence-based quantification

    • Screen hundreds of colonies in parallel using 96-well plate formats

    • Select top performers for secondary validation and sequencing

  • Condition optimization:

    • Design factorial experiments testing multiple variables simultaneously

    • Utilize automated liquid handling for precise media formulation

    • Implement parallel temperature gradient incubation

    • Monitor growth and protein production in real-time with plate readers

  • Functional characterization:

    • Develop phenotypic microarrays for knockout/overexpression strains

    • Perform parallel stress response assays

    • Utilize robotics for automated sample preparation and analysis

  • Interactome mapping:

    • Employ affinity purification with quantitative mass spectrometry

    • Analyze protein complexes under multiple physiological conditions

    • Implement label-free quantitative proteomics approaches similar to those used for YAP/TAZ interactome studies

High-throughput approaches have proven highly effective in similar research contexts. For instance, screening of over 900 colonies expressing different secretion tags for teriparatide and filgrastim identified optimal tags that increased secretion by 10-fold and 5-fold respectively compared to standard approaches .

How can I address poor expression or secretion of YyaP in B. subtilis?

When encountering poor expression or secretion of YyaP, implement this systematic troubleshooting approach:

  • Optimize secretion signal:

    • Test a comprehensive library of secretion peptides (walM, yoqH, aprE, etc.)

    • Screen multiple colonies to identify optimal performers

    • Consider fusion tags that enhance secretion efficiency

  • Address potential toxicity:

    • Switch to tightly controlled inducible promoters

    • Reduce expression temperature (25°C often yields better secretion than 37°C)

    • Titrate inducer concentrations to find optimal expression window

  • Improve protein stability:

    • Add protease inhibitors to culture medium

    • Test protease-deficient B. subtilis strains

    • Optimize codon usage for highly expressed B. subtilis genes

  • Modify culture conditions:

    • Test different media formulations (minimal vs. rich)

    • Optimize culture pH and aeration

    • Adjust harvest timing based on growth phase

  • Genetic construct optimization:

    • Check for potential frameshift mutations or premature stop codons

    • Consider direct PCR amplification and linearization for transformation

    • Verify integration using whole-genome sequencing approaches

Research with other recombinant proteins in B. subtilis has shown that improper secretion tag selection can significantly impact secretion efficiency, with optimal tags improving secretion by up to 10-fold compared to standard options. Additionally, growth temperature significantly affects secretion independent of cell density, with 25°C often yielding optimal secretion despite reduced growth rates .

What strategies can overcome proteolytic degradation of YyaP during expression?

To overcome proteolytic degradation of YyaP during expression and secretion in B. subtilis:

  • Genetic approaches:

    • Utilize protease-deficient B. subtilis strains lacking major extracellular proteases

    • Consider mutations in regulatory genes controlling protease expression

    • Engineer protease recognition sites out of the YyaP sequence

  • Expression optimization:

    • Reduce cultivation temperature to 25°C to minimize protease activity

    • Optimize media composition (higher protein content can serve as alternative protease substrates)

    • Harvest at optimal time points before extensive degradation occurs

  • Process modifications:

    • Add protease inhibitors to culture medium during expression

    • Implement continuous removal of secreted proteins (perfusion systems)

    • Stabilize protein through appropriate buffer formulation

  • Protein engineering:

    • Identify and modify protease-sensitive regions through sequence analysis

    • Add stabilizing domains or partners

    • Consider fusion to naturally secreted B. subtilis proteins with high stability

The effectiveness of these approaches varies with specific proteins. Temperature reduction to 25°C has proven particularly effective for enhancing secretion of intact recombinant proteins in B. subtilis, as demonstrated in studies with therapeutic peptides. Additionally, the choice of secretion signal peptide can significantly impact not only secretion efficiency but also vulnerability to proteolytic degradation .

How can genomic stability of yyaP expression constructs be improved?

Improving genomic stability of yyaP expression constructs in B. subtilis requires addressing several common challenges:

  • Overcome frameshift mutations during integration:

    • Eliminate intermediate cloning steps that can introduce mutations

    • Use direct PCR amplification with high-fidelity polymerase followed by linearization for transformation

    • Screen large numbers of colonies (>40 recommended) to identify intact integrants

  • Stabilize integration site:

    • Target well-characterized neutral loci (amyE, lacA, thrC)

    • Avoid regions with high transcriptional activity that may interfere with insert stability

    • Consider chromosome position effects on expression levels

  • Optimize construct design:

    • Balance expression levels to prevent selection against high-expressing clones

    • Consider codon optimization to match B. subtilis preferences

    • Minimize repetitive sequences that can promote recombination

  • Selection strategy:

    • Maintain selective pressure during cultivation

    • Implement dual selection markers for higher stringency

    • Consider auxotrophic complementation instead of antibiotic resistance

  • Verification approaches:

    • Perform whole-genome sequencing to confirm intact integration

    • Regularly monitor construct integrity during extended cultivation

    • Implement reporter systems to detect expression stability over time

Research with similar recombinant proteins in B. subtilis revealed significant challenges with genomic integration, where multiple attempts resulted in frameshift mutations and premature stop codons in the secretion peptide region. Success was achieved only after eliminating intermediate cloning steps and directly using PCR products for transformation .

How does YyaP expression compare to other uncharacterized B. subtilis proteins?

Comparing YyaP expression to other uncharacterized B. subtilis proteins requires systematic evaluation across multiple parameters:

ParameterComparative Analysis ApproachMethodological Considerations
Expression levelQuantitative comparison using standardized reportersNormalize to biomass; use consistent growth conditions
Secretion efficiencyTest panel of uncharacterized proteins with identical secretion tagsCompare secretion:intracellular ratios; test multiple tags
Genetic stabilityEvaluate integration success rates and mutation frequencySequence multiple clones; compare stability across expression levels
Functional clusteringGroup proteins by expression patterns under various conditionsUse hierarchical clustering of expression profiles
Regulatory networksAnalyze promoter architectures and transcription factor bindingEmploy comparative genomics and ChIP-seq approaches

When studying multiple uncharacterized proteins, researchers often observe significant variability in expression and secretion efficiency even with identical vectors and tags. For example, research with different therapeutic proteins in B. subtilis showed that optimal secretion tags varied dramatically between proteins, with walM performing best for teriparatide while yoqH was superior for filgrastim. This suggests that protein-specific factors significantly influence expression characteristics .

What insights can structural prediction provide about YyaP function?

Structural prediction can provide valuable insights into YyaP function through:

  • Fold recognition and domain identification:

    • Deploy multiple structure prediction tools (AlphaFold, RoseTTAFold)

    • Identify conserved domains and structural motifs

    • Compare predicted structure to characterized protein families

  • Active site prediction:

    • Analyze surface electrostatics and conservation

    • Identify potential binding pockets and catalytic residues

    • Perform virtual docking with potential substrates/ligands

  • Protein-protein interaction surfaces:

    • Predict interaction interfaces using surface analysis

    • Identify coiled-coil, disordered, or other interaction motifs

    • Compare to known interactome data from similar proteins

  • Experimental validation strategies:

    • Design site-directed mutagenesis of predicted functional residues

    • Generate truncation constructs based on domain predictions

    • Test binding partners suggested by structural similarity

  • Evolutionary analysis:

    • Compare predicted structures across orthologs

    • Identify conserved vs. variable structural elements

    • Analyze co-evolution patterns suggesting functional constraints

While specific structural data for YyaP is not available in the provided search results, the approach used for characterizing other proteins can be applied. For instance, interactome studies of YAP/TAZ revealed uncharacterized interaction partners affecting downstream function, demonstrating how structural predictions coupled with interaction studies can elucidate protein function .

What potential biotechnological applications might emerge from YyaP characterization?

The characterization of YyaP could lead to several biotechnological applications depending on its function:

  • Space-based biomanufacturing:

    • If YyaP shows desirable properties, it could be incorporated into astropharmacy applications

    • B. subtilis spores can survive space conditions for extended periods

    • The protein could be produced on-demand from shelf-stable spores

  • Biopharmaceutical production:

    • If YyaP demonstrates therapeutic potential, the B. subtilis secretion system provides advantages

    • Secretion directly into culture medium simplifies downstream processing

    • Absence of endotoxins makes B. subtilis suitable for pharmaceutical applications

  • Biosensing applications:

    • If YyaP binds specific compounds, it could be engineered as a biosensor

    • B. subtilis secretion system would allow simplified sensor production

    • Spore-based formats could enable stable, long-term storage of biosensors

  • Industrial enzyme development:

    • If YyaP shows enzymatic activity, its stability and specificity could be exploited

    • B. subtilis is already widely used for industrial enzyme production

    • Secretion optimization pathways developed for YyaP could benefit other enzymes

While the specific function of YyaP remains to be characterized, the methodologies employed in B. subtilis for other recombinant proteins demonstrate the platform's versatility. For example, the successful secretion of therapeutic peptides like teriparatide and filgrastim shows how uncharacterized proteins, once understood, can be produced efficiently using optimized secretion systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.