Recombinant Bacillus subtilis Uncharacterized serine protease yyxA (yyxA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yyxA; yycK; BSU40360; Uncharacterized serine protease YyxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yyxA
Target Protein Sequence
MVDYEREEEHTTPEQPKRSKKGYFLSSLIGVIVGAVLMAFIMPYLSNEGLDTGALDQQQN NNGRESIRTVNVSVNNAVTKIVSNMSPAVVGVVNIQKSDIWGESGEAGSGSGVIYKKNDH SAYVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFGNSD KVKSGEPVIAIGNPLGLEFAGSVTQGVISGTERAIPVDSNGDGQPDWNAEVLQTDAAINP GNSGGALLNMDGKVIGINSMKIAESAVEGIGLSIPSKLVIPVIEDLERYGKVKRPFLGIE MKSLSDIASYHWDETLKLPKNVTNGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIV DLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKLSSADQLGS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is YyxA serine protease and what are its alternative nomenclatures?

YyxA is one of three members of the HtrA family of serine proteases encoded in the Bacillus subtilis chromosome. The protein is also known by alternative gene names including htrC and yycK. It is classified as an uncharacterized serine protease with the enzyme classification number EC 3.4.21.- . The other two HtrA family members in B. subtilis are YkdA and YvtA, with YyxA being phylogenetically more distant from YkdA than YvtA .

How does YyxA relate structurally to other bacterial serine proteases?

YyxA belongs to the S1B peptidase family based on sequence similarity . Phylogenetic analysis shows that the three B. subtilis HtrA family members (YkdA, YvtA, and YyxA) are more closely related to each other than to any of the E. coli homologs (HtrA, HhoA, and HhoB). Within this family, YyxA appears to be more distantly related to YkdA and YvtA, which share higher sequence similarity with each other . The core domain (catalytic region and one PDZ domain) of these proteases shows approximately 38-40% identity (60-61% similarity) among family members .

What are effective methods for cloning the yyxA gene?

Based on successful cloning strategies used for similar serine proteases like the yyxA from Bacillus licheniformis, the following methodology is recommended:

  • Extract bacterial genomic DNA from Bacillus subtilis strain 168

  • Design primers based on the known yyxA sequence (BSU40360 locus)

  • Amplify the yyxA gene using polymerase chain reaction (PCR)

  • Clone the amplified gene into a suitable cloning vector (such as pTG19-T)

  • Confirm successful cloning by sequencing

For expression purposes, the verified sequence can then be subcloned into an expression vector such as pET28a .

What expression systems are optimal for recombinant production of YyxA?

Multiple expression systems have been successfully used for YyxA production:

Expression HostAdvantagesConsiderations
E. coliHigh yield, simple culture conditions, cost-effectiveMay require optimization of IPTG concentration and temperature
YeastPost-translational modifications, higher solubilityLonger production time, more complex media
BaculovirusHigher molecular weight proteins, complex foldingTechnical complexity, higher cost
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield

For standard research applications, E. coli expression systems are most commonly used, with optimal expression reported at 37°C for 4 hours using 1 mM IPTG induction .

How can I optimize expression conditions for higher yields of soluble YyxA?

To optimize expression conditions for maximum yield of soluble YyxA:

  • Test multiple E. coli host strains (BL21(DE3), Rosetta, Origami)

  • Optimize induction parameters:

    • IPTG concentration (0.1 mM to 1 mM)

    • Induction temperature (16°C, 25°C, 30°C, 37°C)

    • Induction duration (2-16 hours)

  • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

  • Consider the addition of chaperones to enhance proper folding

  • Test different media compositions (LB, TB, auto-induction media)

Based on studies with similar serine proteases, optimal conditions for YyxA production are typically 37°C for 4 hours with 1 mM IPTG in E. coli expression systems .

What is the most effective purification strategy for recombinant YyxA?

A systematic approach to purifying recombinant YyxA should include:

  • Cell lysis: Sonication or pressure-based lysis in an appropriate buffer (typically Tris-based with 50-300 mM NaCl, pH 7.5-8.0)

  • Initial capture: Affinity chromatography using His-tag if the recombinant protein contains a polyhistidine tag

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing: Size exclusion chromatography to remove aggregates and achieve >95% purity

  • Buffer optimization: Testing protein stability in various storage buffers, with typical formulations including Tris-based buffer with 50% glycerol for long-term storage

The purified protein should be assessed by SDS-PAGE to confirm >85% purity and expected molecular weight of approximately 50 kDa .

How can I assess the enzymatic activity of purified YyxA?

Since YyxA is a serine protease, its activity can be measured using several approaches:

  • Synthetic substrates: Use of para-nitroanilide (pNA) peptide substrates that release the chromogenic pNA group upon cleavage

  • Fluorogenic substrates: FRET-based peptides that increase fluorescence upon cleavage

  • Protease assays: Using casein, gelatin, or other protein substrates with detection of cleaved products

  • Zymography: In-gel detection of protease activity using co-polymerized substrates

  • pH and temperature profiling: Assessing activity across different pH values (4-10) and temperatures (20-80°C)

The activity should be measured as specific activity (U/mg) under standardized conditions to allow comparison with other proteases .

What are the best conditions for storing purified YyxA while maintaining activity?

For optimal storage of purified YyxA:

  • Store the protein in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • Add protease inhibitors (if studying the protease in inactive form)

  • Consider lyophilization for very long-term storage (up to 12 months)

It's important to note that repeated freezing and thawing is not recommended as it can significantly reduce enzyme activity .

What is the predicted biological function of YyxA in Bacillus subtilis?

Based on homology to other HtrA family proteases and limited experimental data, YyxA likely functions in:

  • Protein quality control, particularly for membrane or secreted proteins

  • Stress response mechanisms, possibly related to heat or oxidative stress

  • Cell envelope maintenance

While the specific function remains uncharacterized, studies of the HtrA family member YkdA in B. subtilis suggest these proteases play important roles in stress tolerance. Interestingly, YkdA-null mutants display increased tolerance to heat and are 80-fold more resistant to hydrogen peroxide, suggesting complex regulatory relationships between these proteases .

How does YyxA compare functionally to other HtrA family proteases?

The three HtrA-like proteases in B. subtilis (YkdA, YvtA, and YyxA) likely have some overlapping and some distinct functions:

  • All contain the catalytic triad (histidine, aspartate, and serine) characteristic of serine proteases

  • YkdA and YvtA appear to have compensatory expression patterns, with YvtA expression increasing when YkdA is mutated

  • YyxA is more distantly related phylogenetically to YkdA and YvtA

  • Unlike some bacterial HtrA proteases, YkdA mutants show increased (not decreased) stress resistance, suggesting complex regulation

  • YkdA and YvtA share promoter structural features that YyxA may not have

Given these relationships, YyxA may have evolved distinct functions from YkdA and YvtA, possibly in different stress response pathways or cellular locations .

How can I design experiments to elucidate the physiological role of YyxA?

To investigate the physiological function of YyxA:

  • Gene knockout studies:

    • Create a yyxA deletion mutant in B. subtilis

    • Assess phenotypic changes under various stress conditions (heat, oxidative stress, pH, salt)

    • Perform growth curve analysis under standard and stress conditions

  • Expression analysis:

    • Determine conditions that regulate yyxA expression using qRT-PCR or reporter gene fusions

    • Identify potential promoter regulatory elements

    • Compare with expression patterns of other HtrA family members

  • Protein localization:

    • Create GFP/YFP fusion proteins to determine subcellular localization

    • Perform fractionation studies to determine membrane association

  • Substrate identification:

    • Conduct proteomics analyses to identify potential substrates

    • Perform in vitro cleavage assays with candidate substrates

    • Use trapping mutants (inactive protease) to identify interaction partners

These approaches would provide comprehensive insights into YyxA function in B. subtilis .

How is YyxA conserved across Bacillus species and other bacteria?

To analyze the conservation of YyxA across bacterial species:

  • Multiple sequence alignment: Align YyxA sequences from diverse Bacillus species and other bacterial genera

  • Phylogenetic tree construction: Determine evolutionary relationships between YyxA homologs

  • Domain conservation analysis: Identify highly conserved versus variable regions

  • Genomic context analysis: Examine if neighboring genes are also conserved

Studies have shown that B. licheniformis YyxA shares high similarity with proteases from other Bacillus species such as B. subtilis, B. gobiensis, and B. pumilus . This conservation suggests important functional roles maintained throughout evolution in this bacterial group.

What can structural predictions tell us about YyxA function?

Structural analysis using computational prediction tools can reveal important insights:

  • Homology modeling: Using tools like I-TASSER, PHYRE2, RAPTORX, and Modeller to predict 3D structure

  • Active site identification: Locating the catalytic triad residues in the 3D structure

  • Substrate binding pocket analysis: Predicting substrate specificity based on binding pocket properties

  • PDZ domain analysis: Understanding potential protein-protein interactions

Among various prediction tools, PHYRE2 and I-TASSER software have been reported to provide the most desirable models for predicting the three-dimensional structure of similar proteases . These models can guide experimental design for functional studies.

How can I engineer YyxA for enhanced activity or altered specificity?

For protein engineering of YyxA:

  • Structure-guided mutagenesis:

    • Modify active site residues to alter substrate specificity

    • Introduce stabilizing mutations based on structural predictions

    • Create catalytically inactive mutants (S→A in the catalytic triad) for mechanistic studies

  • Directed evolution approaches:

    • Error-prone PCR to generate variant libraries

    • DNA shuffling with related proteases

    • High-throughput screening assays for desired properties

  • Fusion protein strategies:

    • Create chimeric proteins with domains from other proteases

    • Add targeting sequences for altered localization

    • Introduce stimulus-responsive domains for regulated activity

These approaches can generate YyxA variants with potential research or biotechnological applications .

What advanced techniques can reveal the substrate specificity of YyxA?

To comprehensively characterize YyxA substrate specificity:

  • Proteomic approaches:

    • Comparison of wild-type and yyxA mutant proteomes

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) analysis

    • Enrichment of cleaved peptides by N-terminomics

  • Peptide library screening:

    • Positional scanning synthetic combinatorial libraries

    • Multiplex substrate profiling by mass spectrometry

    • Phage display of potential substrates

  • Computational prediction:

    • Machine learning approaches trained on known protease datasets

    • Molecular docking simulations with candidate substrates

    • Sequence motif analysis around cleavage sites

These combined approaches can elucidate both the preferred cleavage motifs and physiological substrates of YyxA .

How can I investigate potential regulatory mechanisms controlling YyxA activity?

To study regulation of YyxA:

  • Transcriptional regulation:

    • Promoter analysis and identification of regulatory motifs

    • ChIP-seq to identify transcription factors binding to the yyxA promoter

    • Analysis of expression under various stress conditions

  • Post-translational regulation:

    • Identification of potential modifying enzymes

    • Mass spectrometry to identify post-translational modifications

    • Site-directed mutagenesis of modified residues

  • Allosteric regulation:

    • Testing potential activators or inhibitors

    • Structural analysis of conformational changes

    • Domain deletion studies to identify regulatory regions

Based on studies of related proteases like YkdA, it would be particularly interesting to examine whether YyxA is regulated by heat shock, oxidative stress, or autoregulatory mechanisms .

How can I address low solubility issues with recombinant YyxA?

If encountering solubility problems with YyxA expression:

  • Expression conditions optimization:

    • Lower induction temperature (16-25°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Use auto-induction media for gentler expression

  • Solubility enhancement strategies:

    • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Co-express with molecular chaperones (GroEL/ES, DnaK)

    • Screen different buffer compositions during purification

  • Protein refolding approaches:

    • Express as inclusion bodies and refold using dialysis

    • Test step-wise reduction of denaturant concentration

    • Add appropriate cofactors or metal ions during refolding

These strategies have been successful with other HtrA family proteases and should be applicable to YyxA .

What are the common pitfalls in measuring YyxA enzymatic activity?

When assessing YyxA activity, researchers should be aware of these potential issues:

  • Auto-proteolysis: YyxA may cleave itself, leading to activity loss over time

  • Substrate selection: Using inappropriate substrates may lead to false negatives

  • Buffer interference: Components like DTT or certain detergents may affect activity

  • Inhibitor contamination: Trace amounts of protease inhibitors can significantly reduce activity

  • pH and temperature sensitivity: Activity may be highly dependent on precise conditions

  • Metal ion requirements: Some serine proteases require specific metal ions for full activity

Control experiments should include known serine proteases (e.g., trypsin) and specific serine protease inhibitors (e.g., PMSF) to validate assay conditions .

What are promising research frontiers for YyxA characterization?

Future research on YyxA could productively focus on:

  • Structural biology:

    • X-ray crystallography or cryo-EM structure determination

    • Structure-function relationships through mutagenesis

    • Conformational dynamics during catalysis

  • Systems biology:

    • Integration of YyxA into stress response networks

    • Interaction mapping with other cellular components

    • Compensatory mechanisms between HtrA family proteases

  • Synthetic biology:

    • Design of artificial regulatory circuits incorporating YyxA

    • Development of YyxA-based biosensors

    • Engineering YyxA for novel substrate specificities

  • Comparative genomics:

    • Evolution of HtrA proteases across bacterial phyla

    • Horizontal gene transfer events involving yyxA

    • Correlation with ecological niches and bacterial lifestyles

Such studies would contribute significantly to our understanding of bacterial proteases and stress response mechanisms .

How might studying YyxA inform broader understanding of bacterial stress responses?

Research on YyxA can provide insights into:

  • Protein quality control mechanisms:

    • How bacteria maintain proteostasis under stress

    • Integration of proteolytic systems with chaperone networks

    • Membrane protein quality surveillance

  • Evolutionary adaptations:

    • How proteolytic systems have evolved across bacterial lineages

    • Specialization of paralogous proteases for distinct functions

    • Conservation of stress response mechanisms

  • Bacterial physiology:

    • Connection between proteolysis and other cellular processes

    • Role of regulated proteolysis in bacterial adaptation

    • Integration of environmental sensing with proteolytic responses

The unexpected phenotype of increased stress resistance in YkdA mutants highlights how studying these proteases can reveal counterintuitive aspects of bacterial biology that expand our understanding of microbial adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.