Recombinant Bacillus subtilis Uncharacterized transmembrane protein yshB (yshB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

YshB is produced using heterologous expression systems. Commercial suppliers and research protocols employ the following strategies:

ParameterDetailsSource
Expression HostE. coli, yeast, baculovirus, or mammalian cells
TagHis-tag (C- or N-terminal) for affinity purification
Purity≥80–85% (verified by SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C to -80°C
YieldCustomizable (typical lyophilized powder or liquid formulations)

Recombinant YshB is often expressed in E. coli due to its cost-effectiveness, though B. subtilis-based systems are also explored for native folding .

Applications in Research

  • Antibody production: Rabbit polyclonal antibodies against YshB are available for Western blotting and ELISA .

  • Structural studies: Used in membrane protein crystallization trials due to its small size and stability in detergents .

  • Functional genomics: Serves as a target for gene knockout studies to elucidate its role in B. subtilis physiology .

Research Gaps and Future Directions

  • Functional characterization: No in vivo studies confirm YshB’s role in B. subtilis.

  • Interaction networks: Potential binding partners or regulatory pathways remain unidentified.

  • Biotechnological potential: Engineered YshB variants could probe membrane protein dynamics or serve as biosensors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
yshB; BSU28600; Uncharacterized transmembrane protein YshB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yshB
Target Protein Sequence
MLDIIILILLLMGTLLGLKRGFILQFIRLTSFILSIAFAALFYKNVAPHLHWIPAPDFSA GQPALSFFTGNLEAAYYNAIAFIVLFIIAKILLRIIGSFLSIVAGIPVIKQINQMLGAVL GFLEVYLFTFVLLYVASVLPVDALQQMMGQSSLANVIINHTPYLSGLLQELWTQYGA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YshB protein and what is currently known about its structure?

YshB is an uncharacterized transmembrane protein from Bacillus subtilis (strain 168) with UniProt accession number P94543. Based on sequence analysis, YshB is a membrane-spanning protein with multiple predicted transmembrane domains . The amino acid sequence suggests a protein with hydrophobic regions characteristic of membrane proteins: mLDIIILILLLMGTLLGLKRGFILQFIRLTSFILSIAFAALFYKNVAPHLHWIPAPDFSAGQPALSFFTGNLEAAYYNAIAFIVLFIIAKILLRIIGSFLSIVAGIPVIKQINQmLGAVLGFLEVYLFTFVLLYVASVLPVDALQQMMGQSSLANVIINHTPYLSGLLQELW .

The predicted structure would need to be verified through experimental techniques such as crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy. Currently, detailed structural information appears to be limited, making this an important area for further research.

How is YshB classified among bacterial membrane proteins?

YshB is classified as an uncharacterized transmembrane protein. In the context of B. subtilis genome annotation approaches, it would likely be categorized among the membrane proteins with unknown function. The B. subtilis genome contains numerous transcription factors and regulatory proteins that have been classified according to their Pfam motifs . While not specifically mentioned in the search results, YshB would be part of the estimated 275 independent transcription factors or regulatory proteins in B. subtilis .

A systematic classification approach would involve analyzing YshB's sequence for conserved domains, comparing it with other characterized proteins using tools like BLAST, and examining its genomic context to identify potential functional relationships with neighboring genes.

What expression systems are available for producing recombinant YshB protein?

Common expression systems for bacterial membrane proteins include:

  • Homologous expression in B. subtilis - Offers the advantage of native processing machinery

  • E. coli expression systems - Including specialized strains optimized for membrane protein expression (C41, C43)

  • Cell-free expression systems - Useful for toxic membrane proteins

  • Eukaryotic expression systems - Such as yeast or insect cells for proteins requiring specific post-translational modifications

Expression vectors should include appropriate tags (His, FLAG, etc.) for purification and detection, along with inducible promoters to control expression levels, which is particularly important for membrane proteins that can be toxic when overexpressed.

What are the predicted functional roles of YshB based on comparative genomics?

While YshB remains uncharacterized, its function might be inferred through comparative analysis with similar proteins in related organisms. For instance, a protein named YshB in Salmonella (though not necessarily homologous) plays a role in intracellular survival and replication, with expression being upregulated upon entry into macrophages . Whether B. subtilis YshB has analogous functions remains to be determined.

Based on approaches used for other membrane proteins, potential functions could include:

  • Transport activity - Similar to how YsbA in B. subtilis functions in pyruvate uptake

  • Signal transduction - Many transmembrane proteins serve as sensors

  • Structural roles - Contributing to membrane integrity

  • Stress response - Involvement in adaptation to environmental changes

A comprehensive genomic context analysis, examining genes co-regulated with yshB under various conditions, could provide insights into its functional networks and potential biological roles.

How does YshB expression change under different growth conditions or environmental stresses?

Understanding the regulation of yshB expression requires systematic investigation under various conditions. This research question could be approached by:

  • Transcriptomic analysis - RNA-seq to examine yshB expression profiles under different growth phases, nutrient limitations, and stress conditions

  • Promoter analysis - Characterizing the yshB promoter region and identifying potential regulatory elements, similar to the approach used in the B. subtilis promoter database

  • Reporter fusion studies - Creating yshB-reporter gene fusions to monitor expression in real-time

The regulatory information of B. subtilis genes has been compiled in databases such as DBTBS, which contains information on binding factors and promoters . This resource could be valuable for analyzing the regulatory elements controlling yshB expression.

What phenotypic changes occur in B. subtilis when YshB is deleted or overexpressed?

To understand YshB function, researchers should examine phenotypic consequences of manipulating its expression:

For deletion studies:

  • Create a clean yshB deletion mutant using homologous recombination

  • Analyze growth parameters (lag time, doubling time, maximum OD)

  • Assess stress tolerance (temperature, pH, salt, antibiotics)

  • Examine morphological changes using microscopy

  • Test metabolic capabilities through substrate utilization assays

For overexpression studies:

  • Construct strains with inducible yshB expression

  • Monitor growth effects upon induction

  • Assess membrane integrity and potential changes in cell morphology

  • Analyze global transcriptional responses using RNA-seq

  • Examine metabolic shifts using metabolomics approaches

The phenotypic analysis approach should be comprehensive, as illustrated by studies on YsbA in B. subtilis, where deletion significantly affected pyruvate utilization .

What techniques are most effective for determining YshB topology and membrane orientation?

Determining the topology of transmembrane proteins requires specialized techniques:

Experimental approaches:

  • Protease accessibility assays - Similar to those used for TMEM106B characterization, where proteases only digest exposed protein regions

  • Glycosylation site mapping - Mutagenesis of predicted glycosylation sites followed by glycosidase treatment can reveal which protein regions are exposed to glycosylation machinery

  • Cysteine accessibility methods - Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents

  • Fluorescence techniques:

    TechniqueApplicationAdvantages
    FRETDistance measurement between domainsNon-invasive, real-time
    GFP fusion analysisLocalization of N/C terminiVisual confirmation in living cells
    Bimolecular fluorescence complementationProtein-protein interactionsDetects transient interactions
  • Membrane fractionation - Separating cytosolic, peripheral, and integral membrane proteins using carbonate extraction and ultracentrifugation methods as described for other membrane proteins

These approaches would help determine whether YshB adopts a type 2 orientation (single transmembrane domain) or a more complex topology with multiple membrane-spanning regions.

What purification strategies are optimal for recombinant YshB protein?

Purifying membrane proteins like YshB presents unique challenges:

Recommended purification workflow:

  • Expression optimization:

    • Test various detergents for solubilization (DDM, LDAO, Fos-choline)

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider fusion partners that enhance solubility and expression

  • Extraction and solubilization:

    • Use gentle detergents to maintain native conformation

    • Consider native nanodiscs or amphipols for detergent-free purification

  • Purification steps:

    • Affinity chromatography using appropriate tags (His, FLAG, etc.)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Quality control:

    • Size exclusion chromatography to assess oligomeric state

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to optimize buffer conditions

Each purification step should be optimized specifically for YshB, as membrane proteins vary greatly in their biochemical properties and stability in different detergents.

What are the best approaches for studying potential interaction partners of YshB?

Understanding YshB's interactome would provide valuable insights into its function:

Recommended interaction analysis methods:

  • Co-immunoprecipitation - Using tagged YshB as bait to pull down interacting proteins

  • Bacterial two-hybrid systems - Modified for membrane protein analysis

  • Proximity labeling approaches:

    TechniquePrincipleAdvantages
    BioIDProximity-dependent biotinylationWorks with transient interactions
    APEXPeroxidase-mediated labelingRapid labeling, subcellular resolution
    Split-TurboIDSplit biotin ligase complementationReduced background
  • Crosslinking mass spectrometry (XL-MS) - To capture direct protein-protein interactions

  • Genetic approaches:

    • Synthetic genetic arrays to identify genetic interactions

    • Suppressor screens to identify genes that compensate for yshB deletion

Similar approaches have been used successfully to characterize the functions of other membrane proteins in bacterial systems, including those involved in regulatory networks .

How might structural biology approaches be applied to resolve YshB's three-dimensional structure?

Resolving YshB's structure would significantly advance understanding of its function:

Structural determination strategy:

  • Crystallography pipeline:

    • Express with fusion partners that facilitate crystallization

    • Screen numerous detergents and lipids to identify optimal conditions

    • Utilize lipidic cubic phase crystallization for membrane proteins

    • Consider antibody fragments to stabilize flexible regions

  • Cryo-EM approach:

    • Particularly valuable if YshB forms complexes

    • Reconstitute in nanodiscs to maintain native lipid environment

    • Use latest direct electron detectors for high-resolution data

  • NMR studies:

    • Suitable for smaller domains or fragments

    • Requires isotopic labeling (^15N, ^13C)

    • Can provide dynamic information not available from static methods

  • Integrative structural biology:

    • Combine multiple low-resolution techniques

    • Utilize computational modeling with experimental constraints

    • Apply distance restraints from crosslinking or FRET experiments

The structural investigation should be iterative, with functional studies informing structural work and vice versa.

What comparative insights can be gained by analyzing YshB homologs across different bacterial species?

Evolutionary analysis can reveal conserved functional elements:

Comparative genomics approach:

  • Phylogenetic profiling:

    • Identify orthologs across bacterial species

    • Map conservation patterns to infer functional constraints

    • Analyze co-evolution with other proteins to predict functional relationships

  • Sequence conservation analysis:

    RegionConservation PatternFunctional Implication
    Transmembrane domainsHigh conservationCritical structural role
    Loop regionsVariablePossible species-specific interactions
    Specific motifsHighly conservedPotential functional sites
  • Genomic context conservation:

    • Examine neighboring genes across species

    • Identify conserved operonic structures

    • Look for co-occurrence patterns with functionally related genes

This comparative approach has proven valuable for other B. subtilis proteins, such as YsbA, where functional insights were gained through comparative studies with similar proteins in other bacterial species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.