Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO)

Shipped with Ice Packs
In Stock

Description

Potential Functional Insights

While YdbO is classified as a transporter, its substrate specificity and transport mechanism remain undefined. B. subtilis employs diverse transporter systems, including:

  • ABC Transporters: Common in Gram-positive bacteria for substrate import/export .

  • Sec and Tat Pathways: General secretion systems for protein translocation .

YdbO’s uncharacterized status suggests it may:

  • Regulate Ion or Small Molecule Transport: Similar to siderophore transporters like YclNOPQ in B. subtilis .

  • Participate in Stress Response: Given B. subtilis’ robust stress adaptation mechanisms .

Production and Purification Workflow

YdbO is produced via heterologous expression in E. coli:

StepDetails
ExpressionInduced in E. coli using standard protocols (e.g., IPTG) .
PurificationNickel affinity chromatography (His tag) followed by lyophilization .
Quality ControlSDS-PAGE validation for purity (>90%) .

Reconstitution in deionized water (0.1–1.0 mg/mL) is recommended, with optional glycerol addition for stability .

Applications and Research Potential

YdbO serves as a tool in:

  • Structural Biology: Studying transporter folding and conformational dynamics.

  • Functional Screening: Identifying substrates via binding assays.

  • Biotechnological Development: Leveraging B. subtilis’ GRAS status for industrial protein production .

Limitations and Future Directions

  • Functional Ambiguity: No direct evidence links YdbO to specific transport activities.

  • Research Gaps: Structural studies (e.g., cryo-EM or X-ray crystallography) are needed to classify its transporter family.

Comparative Context in B. subtilis Transporters

While YdbO is uncharacterized, B. subtilis hosts diverse transporters:

Transporter TypeExampleFunctionSource
ABC Importers (Type I)YtlCDA, GlnQMPHAmino acid/peptide uptake .
ABC Exporters (Hybrid)YhcHI, YhaQPNovel extracellular domain structures .
Siderophore TransportersYclNOPQPetrobactin iron uptake .

YdbO’s classification remains unresolved, necessitating further genomic and biochemical analysis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ydbO; BSU04540; Uncharacterized transporter YdbO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydbO
Target Protein Sequence
MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGLNNGTDIVASVAVLIG LRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGKAIAGGTTETPNLIAAW TALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSAGAFIGVFSSQLKLPWVD PVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTVGRIENVHRLKDVKARYLG STVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVHVHVEPDDIK
Uniprot No.

Target Background

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does ydbO fit within the B. subtilis genome organization?

The ydbO gene is part of the Bacillus subtilis genome, which has been extensively studied and annotated in reference databases such as SubtiList. Within the genomic context, ydbO represents one of the many genes that were initially annotated with a 'y' prefix, indicating its function was unknown during initial genome characterization. As part of ongoing genome annotation efforts, many such 'y' genes have been renamed when their functions were identified, but ydbO remains in the uncharacterized category .

The gene appears in genomics databases alongside its annotation information, cross-references to protein databases, and potentially linked to regulatory networks when information becomes available. It is important to note that SubtiList and other B. subtilis-dedicated resources continue to update gene annotations as new functional data emerges .

What expression systems are available for recombinant ydbO studies?

The most documented expression system for recombinant ydbO is E. coli-based, with the protein typically produced with a His-tag for purification purposes. The commercially available recombinant full-length Bacillus subtilis uncharacterized transporter ydbO is expressed in E. coli with an N-terminal His-tag, which facilitates purification while minimizing interference with the protein's native structure and function .

For research purposes, methodology options include:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, well-established protocols, economicalPotential folding issues with membrane proteins
B. subtilisNative environment, proper foldingLower yield, more complex genetic manipulation
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, potentially lower yield
Yeast (P. pastoris)Good for membrane proteins, eukaryotic processingLonger development time

When selecting an expression system, researchers should consider the downstream applications, required protein purity, and whether native-like membrane insertion is crucial for the planned experiments .

How should researchers design experiments to determine the substrate specificity of ydbO?

Determining substrate specificity of an uncharacterized transporter requires a systematic approach:

  • Bioinformatic prediction: Begin with sequence analysis and structural prediction to identify potential substrate-binding domains and compare with known transporters. While ydbO is uncharacterized, its amino acid sequence can provide initial clues about potential substrate families.

  • Transport assays: Design experiments using reconstituted proteoliposomes containing purified ydbO. Methodologically:

    • Incorporate the recombinant His-tagged ydbO into liposomes

    • Test transport of radiolabeled or fluorescently labeled potential substrates

    • Monitor substrate accumulation inside vesicles over time

    • Compare transport rates with and without electrochemical gradients

  • Substrate screening panel: Test a diverse library of potential substrates including:

Substrate CategoryExamplesDetection Method
IonsNa⁺, K⁺, Ca²⁺, Cl⁻Ion-selective electrodes, fluorescent indicators
SugarsGlucose, maltose, lactoseRadiolabeled substrates, enzymatic assays
Amino acidsAll 20 standard amino acidsHPLC, radiolabeled compounds
NucleotidesATP, GTP, nucleosidesHPLC, bioluminescence assays
PeptidesDi/tri-peptides, antimicrobialsMass spectrometry, fluorescence
VitaminsB vitamins, cofactorsMicrobiological assays, HPLC
  • Competition assays: Once potential substrates are identified, perform competitive inhibition studies to determine specificity and affinity.

  • Genetic approaches: Create knockout strains of ydbO in B. subtilis and assess phenotypic changes in growth under various substrate availability conditions .

What are the best methods for solubilizing and purifying ydbO for structural studies?

Membrane protein solubilization and purification represent significant challenges. For ydbO:

  • Extraction optimization:

    • Test multiple detergents systematically (DDM, LMNG, CHAPS, digitonin)

    • Screen detergent concentrations (typically 1-2% for extraction, 0.1-0.3% for purification)

    • Optimize buffer composition (pH, salt concentration, glycerol content)

    • Consider adding lipids during solubilization to maintain native-like environment

  • Purification strategy:

    • Leverage the His-tag with immobilized metal affinity chromatography (IMAC)

    • Include detergent in all purification buffers at concentrations above CMC

    • Consider size exclusion chromatography as a final polishing step

    • Monitor protein quality by SDS-PAGE and Western blotting

  • Alternative approaches:

    • Styrene-maleic acid lipid particles (SMALPs) extraction to maintain native lipid environment

    • Amphipols for detergent-free handling after initial extraction

    • Nanodiscs for reconstitution into membrane-like environment

The recombinant ydbO is typically provided as a lyophilized powder that can be reconstituted in buffer containing appropriate detergent. Recommendations include reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers assess the quality and functionality of purified recombinant ydbO?

Quality assessment is crucial before proceeding with functional or structural studies:

  • Biophysical characterization:

    • Size exclusion chromatography to verify monodispersity

    • Dynamic light scattering to assess aggregation state

    • Circular dichroism to confirm secondary structure content

    • Thermal shift assays to evaluate stability in different buffer conditions

  • Functional validation:

    • ATPase assays if ydbO is predicted to be ATP-dependent (similar to YdbR which shows ATPase activity)

    • Substrate binding assays using fluorescence-based techniques

    • Reconstitution into proteoliposomes to confirm membrane insertion

    • Electrophysiological measurements if ion transport is suspected

  • Structural integrity:

    • Limited proteolysis to identify stable domains

    • Mass spectrometry to confirm exact mass and post-translational modifications

    • Negative-stain electron microscopy to visualize particles

A typical workflow would involve:

StageTechniqueExpected Outcome
Initial QCSDS-PAGE, Western blot>90% purity, correct MW (~32 kDa with His-tag)
Secondary QCSEC-MALSMonodisperse population, appropriate molecular weight
Functional checkBinding/transport assaySpecific activity with potential substrates
Structural assessmentCD spectroscopyAlpha-helical content consistent with membrane protein

Researchers should establish batch-to-batch consistency criteria before proceeding with detailed characterization studies .

What approaches are recommended for determining the membrane topology of ydbO?

Determining membrane topology is essential for understanding transporter function:

  • Computational prediction:

    • Use multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius)

    • Generate consensus topology model from multiple predictions

    • Identify potential transmembrane helices and their orientation

  • Experimental validation:

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • Reporter fusion approach (PhoA/GFP dual topology reporter system)

    • Epitope insertion followed by immunofluorescence in permeabilized/non-permeabilized cells

    • Limited proteolysis of reconstituted protein in proteoliposomes

  • Advanced structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Cross-linking studies with mass spectrometry analysis

The ydbO sequence analysis suggests multiple transmembrane domains, which is consistent with its classification as a membrane transporter. A systematic experimental approach combining prediction and validation is required for accurate topology mapping .

What are the challenges and solutions for crystallizing membrane transporters like ydbO?

Membrane protein crystallization faces specific challenges:

  • Major challenges:

    • Protein instability outside native lipid environment

    • Conformational heterogeneity due to multiple functional states

    • Limited polar surface area for crystal contacts

    • Detergent micelles interfering with crystal packing

  • Optimization strategies:

    • Extensive detergent screening (>20 different detergents)

    • Lipid cubic phase (LCP) crystallization

    • Addition of specific lipids to stabilize native-like conformation

    • Use of antibody fragments or nanobodies to increase polar surface area

    • Construct optimization (removing flexible regions)

    • Conformational stabilization by inhibitors or substrate analogs

  • Alternative approaches:

    • In meso crystallization methods

    • Bicelle crystallization

    • Fusion protein approaches (inserting well-folding domains)

    • Nanodiscs for maintaining native-like environment

A systematic approach for ydbO crystallization:

StepMethodologyVariables to Screen
Construct optimizationTruncation seriesN/C termini, loop regions
Detergent screeningVapor diffusionDDM, LMNG, UDM, OG, etc.
LCP crystallizationLipidic cubic phaseMonoolein, cholesterol percentage
Additive screeningMatrix approachIons, small molecules, lipids
Crystal optimizationMicroseedingPrecipitant concentration, temperature

When traditional crystallization proves challenging, researchers should consider cryo-EM as an alternative structural approach .

How can researchers apply cryo-electron microscopy to study the structure of ydbO?

Cryo-EM has revolutionized membrane protein structural biology:

  • Sample preparation:

    • Purify ydbO to high homogeneity (>95%)

    • Screen detergents for monodispersity and stability

    • Consider reconstitution into nanodiscs or amphipols

    • Optimize protein concentration (typically 1-5 mg/ml)

    • Test grid types (copper, gold) and surface treatments

  • Data collection strategy:

    • Collect on high-end microscope (Titan Krios, Talos Arctica)

    • Use energy filter to improve contrast

    • Employ direct electron detector with movie mode acquisition

    • Automated data collection with appropriate defocus range

    • Collect sufficient particle numbers (>500,000 initial particles)

  • Image processing workflow:

    • Motion correction and CTF estimation

    • Particle picking (automated with manual inspection)

    • 2D classification to eliminate poor particles

    • Ab initio 3D model generation

    • 3D classification to identify structural states

    • 3D refinement with CTF correction

    • Post-processing and resolution estimation

  • Validation and interpretation:

    • Resolution assessment using gold-standard FSC

    • Model building using sequence information and secondary structure prediction

    • Refinement against EM density

    • Validation using independent datasets

For ydbO specifically, given its relatively small size (~32 kDa), consider:

  • Using a larger scaffold (nanodiscs with defined size)

  • Adding an antibody fragment to increase molecular weight

  • Collecting data with a Volta phase plate to enhance contrast

The structural insights gained could provide crucial information about substrate binding sites and conformational states of this uncharacterized transporter .

How can researchers develop a knockout/complementation system to study ydbO function in B. subtilis?

A genetic approach to functional characterization:

  • Knockout strain construction:

    • Design homologous recombination strategy targeting ydbO

    • Utilize CRISPR-Cas9 system optimized for B. subtilis

    • Construct deletion vector with antibiotic resistance marker

    • Transform B. subtilis with linearized deletion construct

    • Select transformants on appropriate antibiotics

    • Verify deletion by PCR and sequencing

  • Phenotypic characterization:

    • Growth curve analysis under various conditions (media types, stress conditions)

    • Metabolic profiling using LC-MS

    • Transcriptional response analysis via RNA-seq

    • Membrane potential and intracellular pH measurements

    • Transport assays with various potential substrates

    • Stress resistance tests (osmotic, pH, temperature)

  • Complementation system:

    • Clone wild-type ydbO into an inducible expression vector

    • Transform the knockout strain with the complementation construct

    • Verify expression by qRT-PCR and Western blotting

    • Test for restoration of wild-type phenotypes

    • Create point mutations in conserved residues for structure-function studies

This approach can provide insights similar to those gained from studies of other B. subtilis proteins like YdbR, where deletion strains showed reduced growth rates compared to wild type, especially at lower temperatures (22°C), suggesting functional importance under specific conditions .

What are the best approaches for identifying potential interaction partners of ydbO?

Identifying interaction partners can provide functional insights:

  • In vivo approaches:

    • Bacterial two-hybrid systems

    • In vivo cross-linking followed by co-immunoprecipitation

    • Proximity-dependent biotin labeling (BioID or APEX2)

    • Fluorescence resonance energy transfer (FRET)

    • Split-GFP complementation assays

  • In vitro approaches:

    • Pull-down assays using purified His-tagged ydbO

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Co-immunoprecipitation with specific antibodies

    • Mass spectrometry-based interactome analysis

  • Systems biology approaches:

    • Correlation analysis of gene expression data

    • Synthetic genetic array (SGA) analysis

    • Bioinformatic prediction based on genomic context

    • Integration with B. subtilis regulatory network models

    • Comparison with known transporter complexes

A comprehensive interaction mapping workflow:

TechniquePurposeExpected Outcome
Co-expression analysisIdentify genes with similar expression patternsCandidate functional partners
Bacterial two-hybridScreen for direct protein-protein interactionsBinary interaction map
Pull-down + MSIdentify physical interaction partnersComplete interactome
Genetic interactionsMap functional relationshipsPathway connections
Validation studiesConfirm specific interactionsVerified interaction network

The integration of data from these approaches with existing B. subtilis global regulatory network information can place ydbO in its proper cellular context .

How can researchers assess the role of ydbO in B. subtilis adaptation to environmental stresses?

Environmental adaptation studies:

  • Stress response experiments:

    • Compare wild-type and ΔydbO strains under various stresses:

      • Temperature (heat shock, cold shock)

      • Osmotic stress (high salt, drought)

      • Nutrient limitation

      • pH fluctuations

      • Anaerobic conditions

      • Antimicrobial compounds

    • Monitor growth rates, survival, and recovery

  • Transcriptional analysis:

    • RNA-seq to identify differentially expressed genes

    • qRT-PCR validation of key stress response genes

    • Promoter-reporter fusion assays to monitor expression dynamics

    • ChIP-seq to identify potential regulators of ydbO

  • Physiological measurements:

    • Membrane potential using fluorescent dyes

    • Intracellular pH monitoring

    • Metabolite transport assays under stress conditions

    • ATP levels and energy charge

    • Reactive oxygen species detection

  • Laboratory evolution approach:

    • Subject B. subtilis to extended growth under specific stresses

    • Compare evolution trajectories of wild-type and ΔydbO strains

    • Whole genome sequencing to identify adaptive mutations

    • Assess whether ydbO undergoes adaptive changes

    • Analyze epistatic interactions with other stress response systems

This approach leverages B. subtilis as an ideal subject for laboratory evolution experiments, which can reveal how bacteria adapt to environmental challenges. The results can be analyzed using whole genome sequencing and various omics technologies to understand the role of specific genes like ydbO in adaptation processes .

How conserved is ydbO across different Bacillus species and other bacterial genera?

Evolutionary conservation analysis:

  • Sequence conservation mapping:

    • Perform BLAST searches against bacterial genomes

    • Identify orthologs across Bacillus species

    • Extend search to other Firmicutes and more distant bacteria

    • Calculate sequence identity and similarity percentages

    • Generate multiple sequence alignments

  • Domain architecture analysis:

    • Identify conserved protein domains

    • Map conservation onto predicted membrane topology

    • Determine if transmembrane regions are more conserved than loops

    • Identify potential substrate-binding regions based on conservation

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Compare ydbO evolution to species evolution (gene vs. species trees)

    • Identify instances of horizontal gene transfer

    • Calculate evolutionary rates in different lineages

  • Genomic context analysis:

    • Examine gene neighborhood across species

    • Identify conserved operons or gene clusters

    • Look for co-evolution with potential functional partners

    • Assess if genomic context provides functional clues

A systematic conservation analysis can provide insights into the evolutionary history and functional importance of ydbO, similar to approaches used for other B. subtilis genes in comparative genomics studies .

What computational approaches can predict the substrate and mechanism of ydbO transport?

Computational prediction methods:

  • Sequence-based approaches:

    • Motif identification and comparison with characterized transporters

    • Hidden Markov Models for transporter classification

    • Identification of conserved residues likely involved in substrate binding

    • Machine learning algorithms trained on known transporters

  • Structure-based approaches:

    • Homology modeling based on known transporter structures

    • Molecular docking of potential substrates

    • Molecular dynamics simulations to study conformational changes

    • Binding site prediction algorithms

    • Electrostatic potential mapping

  • Systems biology approaches:

    • Genome-wide association studies linking transporter presence with metabolic capabilities

    • Metabolic modeling to predict necessary transport functions

    • Integration with transcriptional network models

    • Co-expression pattern analysis with genes of known function

  • Combined predictive workflow:

ApproachMethodExpected Output
Primary classificationTransporter Classification Database alignmentFamily/subfamily assignment
Substrate predictionMachine learning algorithms (RF, SVM, NN)Ranked list of potential substrates
Mechanism predictionStructural comparison with characterized transportersTransport mechanism class
Energy couplingMotif analysis, threadingATP-dependent/symporter/antiporter classification
Validation targetsMolecular dynamics, in silico mutagenesisKey residues for experimental testing

These computational approaches can guide experimental design by narrowing down potential substrates and mechanisms, making the functional characterization more efficient .

How can researchers integrate ydbO into the wider regulatory networks of B. subtilis?

Network integration approaches:

  • Transcriptional regulation analysis:

    • RNA-seq under various conditions to determine ydbO expression patterns

    • ChIP-seq to identify transcription factors binding to ydbO promoter

    • Promoter dissection using reporter fusion assays

    • Integration with existing B. subtilis regulatory network models

  • Network analysis techniques:

    • Co-expression network construction

    • Bayesian network inference

    • Network component analysis (NCA) to estimate transcription factor activities

    • Machine learning for network reconstruction

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate ydbO expression with metabolite levels

    • Map ydbO to relevant metabolic pathways

    • Use model selection to expand transcriptional regulatory network

  • Experimental validation:

    • EMSA to confirm predicted transcription factor binding

    • Genetic perturbation of potential regulators

    • Synthetic biology approaches to rewire regulatory connections

    • Single-cell analysis to study noise in ydbO expression

The B. subtilis global regulatory network can be expanded using approaches similar to those employed in previous studies, which combined network component analysis and model selection with transcriptomics data to predict novel regulatory interactions. Such approaches could place ydbO within its appropriate regulatory context in the cell .

How can researchers develop high-throughput screening assays to identify substrates or inhibitors of ydbO?

Advanced screening methodologies:

  • Cell-based transport assays:

    • Engineer reporter strains where growth depends on ydbO function

    • Develop fluorescent or luminescent readouts for transport activity

    • Design counter-selection systems for inhibitor screening

    • Utilize flow cytometry for single-cell analysis

  • In vitro high-throughput approaches:

    • Reconstitute ydbO in proteoliposomes with encapsulated indicators

    • Develop fluorescence-based transport assays in 384-well format

    • Setup automated liquid handling for compound library screening

    • Design label-free detection systems (SURFE²R, SPR)

  • Library design considerations:

    • Natural product collections for substrate identification

    • Fragment-based libraries for inhibitor development

    • Focused libraries based on bioinformatic predictions

    • Diversity-oriented synthetic collections

  • Screening workflow optimization:

StageMethodologyThroughputResolution
Primary screenCell-based fluorescence>100,000 compoundsLow (binary hit/no-hit)
Secondary validationDose-response curves~1,000 hitsMedium (potency ranking)
Mechanism confirmationTransport assays with purified protein~100 confirmed hitsHigh (kinetic parameters)
Specificity profilingPanel of related transporters~25 lead compoundsHigh (selectivity index)
  • Data analysis and follow-up:

    • Machine learning for hit prediction and expansion

    • Structure-activity relationship studies

    • Target engagement confirmation

    • Resistance mutation mapping for binding site identification

These approaches can build upon methodologies used for characterizing other B. subtilis proteins like YdbR, adapting techniques for membrane protein research while maintaining high experimental throughput .

What advanced imaging techniques can reveal the subcellular localization and dynamics of ydbO in living B. subtilis cells?

Cutting-edge imaging approaches:

  • Fluorescent protein fusion strategies:

    • C-terminal vs. N-terminal GFP/mCherry fusions

    • Split-fluorescent protein complementation

    • SNAP/CLIP/Halo-tag labeling for pulse-chase experiments

    • Optimization for membrane protein visualization

    • Functional validation of fusion constructs

  • Super-resolution microscopy techniques:

    • Structured illumination microscopy (SIM)

    • Stimulated emission depletion (STED) microscopy

    • Photo-activated localization microscopy (PALM)

    • Single-molecule tracking with high-speed acquisition

    • Correlative light and electron microscopy

  • Dynamic imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP)

    • Fluorescence correlation spectroscopy (FCS)

    • Single-particle tracking to measure diffusion coefficients

    • Förster resonance energy transfer (FRET) for interaction studies

    • Optogenetic approaches to control transporter activity

  • Multi-color imaging applications:

    • Co-localization with membrane domain markers

    • Tracking with cell cycle or differentiation markers

    • Simultaneous visualization of substrate and transporter

    • Integration with biosensors for local pH or membrane potential

  • Image analysis methodologies:

    • Particle tracking algorithms

    • Diffusion coefficient calculation

    • Cluster analysis

    • Spatio-temporal correlation

    • Machine learning for pattern recognition

These approaches can provide insights into where ydbO localizes within the B. subtilis membrane, whether it forms clusters or is uniformly distributed, and how its localization changes under different conditions or stages of the bacterial life cycle .

How can systems biology approaches integrate ydbO function into whole-cell models of B. subtilis?

Integrative systems biology strategies:

  • Multi-scale modeling approaches:

    • Incorporate ydbO transport kinetics into genome-scale metabolic models

    • Develop ordinary differential equation (ODE) models of relevant pathways

    • Agent-based modeling for spatial aspects of transport processes

    • Constraint-based modeling to predict phenotypic consequences

    • Whole-cell modeling integration

  • Parameter estimation methods:

    • Bayesian parameter inference from experimental data

    • Sensitivity analysis to identify critical parameters

    • Ensemble modeling to account for parameter uncertainty

    • Machine learning for parameter prediction from sequence

    • Multi-objective optimization for model fitting

  • Model validation experiments:

    • Design experiments to test model predictions

    • Generate quantitative data for model refinement

    • Create defined perturbations to test model robustness

    • Time-resolved measurements for dynamic model validation

    • Single-cell measurements to capture cell-to-cell variability

  • Integration with existing B. subtilis models:

    • Connect with established regulatory network models

    • Incorporate into metabolic flux models

    • Link with cell cycle and differentiation models

    • Integrate with stress response networks

    • Connect with spore formation models

This systems biology approach can help place ydbO in its broader cellular context, potentially revealing unexpected connections to other cellular processes, similar to how other B. subtilis proteins have been integrated into comprehensive cellular models through approaches like network component analysis and model selection .

How can researchers address protein stability issues when working with recombinant ydbO?

Stability optimization strategies:

  • Buffer optimization:

    • Systematic screening of pH ranges (typically pH 6.0-8.0)

    • Varying salt concentrations (100-500 mM NaCl)

    • Addition of stabilizing agents (glycerol 5-20%, sucrose)

    • Testing different detergents and detergent concentrations

    • Incorporation of lipids to mimic native environment

  • Thermal stability assessment:

    • Differential scanning fluorimetry (nanoDSF)

    • Circular dichroism thermal melts

    • Activity assays after thermal challenge

    • Stability comparison of different constructs

    • Additive screening for stabilization

  • Long-term storage considerations:

    • Flash-freezing protocols optimization

    • Lyophilization with appropriate excipients

    • Addition of cryoprotectants (trehalose, glycerol)

    • Aliquoting strategies to avoid freeze-thaw cycles

    • Storage buffer composition optimization

  • Construct engineering approaches:

    • Terminal truncations to remove flexible regions

    • Thermostabilizing mutations based on structural information

    • Fusion partners for stability enhancement

    • Disulfide engineering for conformational stabilization

    • Surface entropy reduction

Researchers should systematically test stability under various conditions and document optimal handling procedures. For the commercially available recombinant ydbO, it's recommended to add 5-50% glycerol for long-term storage at -20°C/-80°C, with 50% being the default glycerol concentration. Avoiding repeated freeze-thaw cycles is critical for maintaining protein integrity .

What strategies can resolve expression and purification challenges with recombinant ydbO?

Optimization approaches for challenging membrane proteins:

  • Expression troubleshooting:

    • Test multiple E. coli strains (BL21(DE3), C41/C43, Rosetta)

    • Optimize induction parameters (temperature, inducer concentration, time)

    • Consider autoinduction media for gradual expression

    • Test different promoter strengths and vector systems

    • Co-express with chaperones or foldases

  • Solubilization optimization:

    • Systematic detergent screening (starting with mild detergents)

    • Two-step solubilization protocols

    • Evaluate different solubilization temperatures and times

    • Test detergent mixtures or detergent-lipid mixtures

    • Consider nanodiscs or SMALPs for native-like extraction

  • Purification strategy refinement:

    • Optimize IMAC conditions (imidazole concentration, flow rate)

    • Add detergent screening during purification steps

    • Incorporate size exclusion chromatography for monodispersity

    • Consider on-column detergent exchange

    • Test different column materials and chromatography methods

  • Quality control checkpoints:

StageAssessment MethodAcceptance Criteria
ExpressionWestern blotClear band at expected MW
SolubilizationComparing soluble vs. insoluble fractions>70% in soluble fraction
IMAC purificationSDS-PAGE>80% purity, correct MW
SEC purificationChromatogram, dynamic light scatteringSingle monodisperse peak
Final productActivity assay, negative stain EMFunctional, homogeneous sample

For recombinant His-tagged ydbO, researchers should follow recommended reconstitution procedures, using deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol for stability .

How can contradictory functional data for ydbO be reconciled through experimental design?

Resolving experimental discrepancies:

  • Sources of experimental variation:

    • Different expression constructs and tags

    • Varying buffer compositions and pH

    • Different detergents or reconstitution methods

    • Cell-based vs. in vitro assays

    • Strain differences or genetic background effects

  • Systematic validation approach:

    • Reproduce published experiments with identical conditions

    • Test multiple independent methods for the same measurement

    • Compare results across different laboratories

    • Develop quantitative assays with appropriate controls

    • Perform dose-response experiments rather than single-point measurements

  • Statistical analysis considerations:

    • Apply appropriate statistical tests for significance

    • Control for multiple testing when screening conditions

    • Use sufficient biological and technical replicates

    • Consider Bayesian approaches to integrate prior knowledge

    • Meta-analysis of all available data

  • Reconciliation strategies:

    • Develop unified models that explain apparently contradictory results

    • Consider context-dependence of protein function

    • Test for conformational heterogeneity affecting function

    • Evaluate impact of experimental conditions on observed function

    • Design decisive experiments to distinguish between competing hypotheses

  • Reporting standards:

    • Document all experimental conditions thoroughly

    • Share raw data and analysis methods

    • Validate key findings with orthogonal approaches

    • Acknowledge limitations and consider alternative interpretations

    • Design follow-up studies to address specific contradictions

This systematic approach can help researchers navigate the complex landscape of functional characterization for uncharacterized transporters like ydbO, where initial results might appear contradictory due to the multifaceted nature of membrane protein function and the variability in experimental systems .

How might ydbO research contribute to our understanding of bacterial membrane transport evolution?

Evolutionary insights and future directions:

  • Ancestral sequence reconstruction:

    • Reconstruct ancestral sequences of ydbO

    • Express and characterize ancestral proteins

    • Track functional shifts throughout evolutionary history

    • Identify key mutations that altered substrate specificity

    • Map evolutionary trajectory of transport mechanism

  • Comparative genomics expansion:

    • Analyze ydbO distribution across bacterial diversity

    • Correlate presence/absence with ecological niches

    • Identify horizontal gene transfer events

    • Study co-evolution with metabolic pathways

    • Examine selective pressures on transporter evolution

  • Experimental evolution approaches:

    • Subject B. subtilis to selection for altered transport function

    • Sequence evolved strains to identify adaptive mutations

    • Reconstitute mutations in wild-type background

    • Test for expanded or altered substrate specificity

    • Examine trade-offs between specificity and efficiency

  • Structural evolution analysis:

    • Compare structures across evolutionary distance

    • Identify conserved functional cores vs. variable regions

    • Map substrate specificity determinants

    • Study evolution of oligomerization interfaces

    • Analyze co-evolution of residue networks

This research direction leverages B. subtilis as an ideal subject for laboratory evolution experiments, which can help elucidate how these bacteria have successfully adapted to diverse environments throughout their long evolutionary history, potentially spanning up to 3 billion years .

What are the potential biotechnological applications of engineered ydbO variants?

Biotechnological exploitation strategies:

  • Transport engineering applications:

    • Develop ydbO variants with altered substrate specificity

    • Create transporters for non-natural compounds

    • Engineer increased transport efficiency for biotechnology applications

    • Design conditional transporters for controlled uptake/export

    • Create biosensor systems based on transport activity

  • Synthetic biology integration:

    • Incorporate engineered transporters into metabolic engineering projects

    • Design transport systems for novel metabolic pathways

    • Create orthogonal transport systems for synthetic circuits

    • Develop transporters as actuators in synthetic biology

    • Establish genetic circuits controlling transporter expression

  • Structure-based engineering approaches:

    • Computational design of binding pocket modifications

    • Directed evolution for novel functions

    • Domain swapping with other transporters

    • De novo design of transport modules

    • Engineering of regulatory domains

  • Potential applications table:

Application AreaEngineering ApproachPotential Outcome
BioremediationSubstrate specificity modificationTransporters for environmental pollutants
BioproductionExport efficiency enhancementImproved product secretion
BiosensingCoupling transport to reporter systemsWhole-cell biosensors for analytes
BiomedicineDrug resistance mechanism understandingNovel antimicrobial targets
Synthetic cellsMinimal transport system designControllable membrane permeability

These applications build on the tradition of B. subtilis as a model organism for laboratory experimentation and genetic manipulation, extending its utility from basic science to biotechnological innovation .

How can integrative structural biology approaches advance our understanding of ydbO function?

Next-generation structural approaches:

  • Hybrid structural methods:

    • Combine cryo-EM with X-ray crystallography data

    • Integrate small-angle X-ray scattering (SAXS) for solution structure

    • Use solid-state NMR for dynamic regions

    • Apply mass spectrometry for conformational analysis

    • Leverage computational modeling to integrate disparate data

  • Dynamic structural biology:

    • Time-resolved structural studies (TR-XFELs, TR-EM)

    • EPR for conformational changes during transport

    • Single-molecule FRET to track conformational states

    • Molecular dynamics simulations across microsecond timescales

    • Markov state modeling of conformational landscapes

  • In situ structural approaches:

    • Cryo-electron tomography of ydbO in native membranes

    • In-cell NMR for structural assessment in living bacteria

    • Correlative light and electron microscopy

    • Mass photometry for native complex analysis

    • Cellular cryo-FIB-milling combined with cryo-EM

  • Integrative modeling pipeline:

    • Gather constraints from multiple experimental sources

    • Develop integrative modeling platforms for membrane proteins

    • Incorporate coevolutionary constraints from sequence analysis

    • Validate models with orthogonal structural techniques

    • Iteratively refine models with new experimental data

These approaches can provide unprecedented insights into the structural basis of ydbO function, capturing not just static snapshots but the dynamic conformational changes associated with the transport cycle. This integrative approach is particularly valuable for challenging membrane proteins where no single structural technique may provide complete information .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.