Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Hypothetical Roles

While yeaB’s function is uncharacterized, genomic and structural clues suggest potential roles:

  • Manganese Efflux: The synonym “Manganese efflux system protein MneS” implies a possible role in metal ion transport, though experimental validation is lacking .

  • Transporter Family: The absence of functional studies precludes definitive classification, but its sequence may align with transporter superfamilies (e.g., APC or ABC families) observed in other B. subtilis proteins like YveA (aspartate/glutamate uptake) or AraE (xylose transport) .

  • Regulatory Context: No direct evidence links yeaB to stress responses or alternative lifestyles (e.g., biofilm formation, sporulation), unlike the ABC transporter YtrBCDEF, which influences cell wall thickness and genetic competence .

Research Applications and Challenges

Applications:

  • Biochemical Assays: The His-tagged recombinant protein enables substrate-binding studies or transport activity assays in vitro.

  • Structural Biology: Full-length expression facilitates crystallization for 3D structure determination, aiding functional predictions.

  • Control in Transport Studies: Serves as a negative control in experiments targeting characterized transporters (e.g., YveA, AraE).

Challenges:

  • Unresolved Functionality: No published studies confirm yeaB’s substrate specificity or transport mechanism.

  • Limited Homology: Unlike YveA or AraE, yeaB lacks clear sequence homology to well-characterized transporters, complicating functional inference.

Comparative Analysis with Related Transporters

TransporterFunctionSubstratesKey Features
yeaBUncharacterized (hypothetical)Unknown (Mn²⁺ suggested) His-tagged, full-length, E. coli-expressed
YveAAspartate/glutamate uptakel-Aspartate, l-glutamate 14 TMS, APC superfamily (AGT family)
AraEArabinose/xylose symportXylose, arabinose Inducible expression, improves xylose utilization
YtrBCDEFABC transporter affecting cell wallUnknown (acetoin suggested) Regulates competence, sporulation, biofilm formation

Future Directions

  • Functional Characterization: Prioritize substrate identification (e.g., metal ions, amino acids) using isotope-labeled assays or electrophysiology.

  • Structural Elucidation: Solve crystal/NMR structures to predict binding pockets and transport mechanisms.

  • Genetic Knockout Studies: Investigate phenotypic effects of yeaB deletion in B. subtilis under stress conditions (e.g., metal toxicity, nutrient deprivation).

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
mneS; ydxT; yeaB; BSU06320; Manganese efflux system protein MneS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yeaB
Target Protein Sequence
MERYDELKKGESGALVSIAAYLVLSAIKLIIGYLFHSEALTADGLNNTTDIIASVAVLIG LRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGESIFSAKQETPDMIAAW TAAGGAVLMLIVYRYNKRLAKKVKSQALLAAAADNKSDAFVSIGTFIGIVAAQFHLAWID TVTAFVIGLLICKTAWDIFKESSHSLTDGFDIKDISAYKQTIEKISGVSRLKDIKARYLG STVHVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSHVHMEPLEQK
Uniprot No.

Target Background

Function
This protein functions as a secondary manganese efflux system, potentially playing a role in preventing manganese intoxication.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What makes Bacillus subtilis suitable for expressing uncharacterized transporters like YeaB?

B. subtilis offers several advantages as an expression host for membrane transporters. Its GRAS status ensures safety in laboratory settings, while its remarkable ability to absorb and incorporate exogenous DNA facilitates genetic manipulation. The bacterium possesses sophisticated secretion systems, including the general secretion pathway (Sec) and the Twin-arginine translocation (Tat) system, which can be leveraged for membrane protein expression. Additionally, decades of research on B. subtilis biology have yielded extensive genetic engineering tools, including various plasmids, promoter systems, and induction methods . Unlike many other bacterial hosts, B. subtilis has a natural competence system that simplifies transformation procedures, making it particularly suitable for iterative genetic modifications often required when working with uncharacterized transporters.

What are the common challenges in expressing uncharacterized transporters in B. subtilis?

Expressing uncharacterized transporters presents several challenges:

  • Protein misfolding and aggregation due to hydrophobic transmembrane domains

  • Toxicity to host cells from overexpression of membrane proteins

  • Low expression yields compared to cytosolic proteins

  • Difficulty in determining optimal growth conditions without prior knowledge of the transporter function

  • Challenges in protein purification while maintaining native conformation

Additionally, B. subtilis specifically presents challenges due to its robust extracellular protease system that can degrade heterologous proteins. Cell autolysis during stationary phase can also compromise protein yields . For uncharacterized transporters like YeaB, these challenges are compounded by the lack of prior knowledge regarding substrate specificity, which complicates functional validation.

How can I determine if an uncharacterized transporter belongs to a specific transporter family?

Determining the transporter family involves a systematic bioinformatic approach:

  • Sequence Analysis: Perform BLAST searches against characterized transporters

  • Domain Identification: Use tools like Pfam, PROSITE, or InterPro to identify conserved domains

  • Transmembrane Topology Prediction: Use algorithms like TMHMM or Phobius to predict membrane-spanning regions

  • Phylogenetic Analysis: Construct phylogenetic trees with known transporters to infer evolutionary relationships

  • Structural Prediction: Use homology modeling to predict structure based on similar transporters

For YeaB specifically, comparison with characterized MFS (Major Facilitator Superfamily) transporters may be informative, as many uncharacterized transporters in B. subtilis belong to this family. The identification of conserved sequence motifs associated with substrate binding or energy coupling can provide insights into potential function. If YeaB shows similarities to characterized transporters like AraE (a proton symporter in B. subtilis), this might suggest similar transport mechanisms .

What expression systems are optimal for studying uncharacterized transporters in B. subtilis?

The optimal expression system depends on research objectives and transporter characteristics:

Expression SystemPromoterInduction MethodAdvantagesLimitations
IPTG-induciblePspacIPTG additionTight regulation, dose-dependent expressionLeaky expression in some strains
Xylose-induciblePxylAXylose additionWell-characterized, gradual inductionCatabolite repression by glucose
Self-inducibleConstitutiveNone requiredSimple cultivation, no inducer costsLimited control over expression level
Double promoterTandem promotersMultiple inducersHigher expression levelsComplex regulation
Integration-basedVariousDepends on promoterStable expression, defined copy numberGenerally lower yields than plasmid-based

For uncharacterized transporters like YeaB, the xylose-inducible PxylA promoter system offers several advantages. This system has been successfully used for expressing membrane proteins, as demonstrated with the arabinose:H⁺ symporter AraE . The gradual induction profile helps minimize toxicity, while the ability to fine-tune expression levels allows optimization for functional studies. If expression affects growth significantly, integration-based systems with controlled copy number might be preferable to prevent metabolic burden.

How can I optimize the genetic construct for expressing an uncharacterized transporter?

Optimizing genetic constructs for membrane transporters requires careful consideration:

  • Promoter Selection: Choose promoters with appropriate strength; too strong can cause toxicity, too weak may yield insufficient protein

  • Signal Peptide Engineering: For transporters requiring membrane localization, select an appropriate signal peptide (e.g., from native B. subtilis membrane proteins)

  • Codon Optimization: Adjust codon usage to match B. subtilis preferences while avoiding rare codons

  • Addition of Tags: Consider fusion tags (His, FLAG, etc.) for detection and purification, positioned to minimize interference with function

  • Ribosome Binding Site (RBS) Engineering: Optimize the RBS sequence and spacing for efficient translation initiation

  • Terminator Selection: Include efficient transcription terminators like the fba terminator to prevent read-through

For YeaB specifically, construct design should consider its predicted membrane topology. If terminal tags interfere with membrane insertion, consider internal tags in predicted loop regions. Additionally, inclusion of a xylose-inducible xylA promoter coupled with a strong RBS and the fba terminator has proven successful for other transporters in B. subtilis .

What chassis strain modifications can improve expression of uncharacterized transporters?

Strategic modifications to the B. subtilis chassis can significantly improve transporter expression:

  • Protease-Deficient Strains: Deletion of genes encoding extracellular proteases (e.g., nprE, aprE) to reduce protein degradation

  • Autolysis-Resistant Strains: Knockout of autolysis genes (lytC, sigD, pcfA, flgD) to increase biomass by 10-20% and extend cultivation time

  • Secretion Pathway Enhancement: Overexpression of components of the Sec or Tat pathways to improve membrane protein translocation

  • Chaperone Co-expression: Addition of molecular chaperones to assist proper folding

  • Lifespan Engineering: Modification of chronological and replicative lifespan genes to alter cell physiology and improve protein yields

Recent advances in chassis cell engineering demonstrate that systematic modification of cell lifespan can alter morphology and improve robustness. Strains with knockout of prophage-associated genes (e.g., xpf) or spore-associated genes (e.g., skfA, sdpC) have shown increased biomass and improved heterologous protein expression . For membrane transporters like YeaB, strains with modified cell wall properties might be advantageous, as the cell wall thickness and composition influence membrane protein insertion.

What methods can I use to determine the substrate specificity of an uncharacterized transporter?

Determining substrate specificity requires a systematic approach:

  • Growth-Based Assays: Test growth on minimal media with different potential substrates; improved growth may indicate transport capability

  • Radioactive Transport Assays: Use radiolabeled substrates to directly measure uptake rates

  • Fluorescent Substrate Analogs: Employ fluorescent compounds to track transport activity

  • Comparative Phenotypic Analysis: Compare growth phenotypes between wild-type and transporter-overexpressing strains on different substrates

  • Competition Assays: Determine if non-labeled potential substrates can compete with a known transported substrate

For uncharacterized transporters like YeaB, a comprehensive substrate screen is often necessary. The approach used for identifying AraE as a xylose transporter provides a template: systematic analysis of cell growth, substrate consumption rates, and respiratory quotient in defined media with different carbon sources . If YeaB belongs to the MFS family, testing common MFS substrates (sugars, amino acids, ions) would be a logical starting point.

How can I assess the impact of transporter overexpression on cell physiology?

Transporter overexpression can significantly impact cellular physiology through various mechanisms:

  • Growth Analysis: Monitor growth curves to assess impact on growth rate and biomass formation

  • Respiratory Quotient: Measure oxygen consumption and CO₂ production rates to evaluate metabolic changes

  • Cell Morphology: Examine changes in cell size, shape, and membrane integrity using microscopy

  • Transcriptomics/Proteomics: Analyze global gene/protein expression changes in response to transporter overexpression

  • Cell Wall Analysis: Evaluate changes in cell wall thickness and composition, particularly relevant for membrane proteins

Research on the YtrBCDEF ABC transporter demonstrates that overexpression can dramatically alter cellular phenotypes, including genetic competence and biofilm formation . These effects were linked to changes in cell wall thickness. For uncharacterized transporters like YeaB, similar analyses would provide insights into physiological impacts beyond their primary transport function.

What approaches can help resolve contradictory functional data for uncharacterized transporters?

Resolving contradictory data requires systematic troubleshooting:

  • Expression Level Optimization: Test multiple expression levels to identify potential toxicity or insufficient expression issues

  • Control Experiments: Include positive and negative controls for each functional assay

  • Alternative Assay Methods: Apply different techniques to measure the same parameter

  • Strain Background Effects: Test the transporter in different genetic backgrounds to identify potential interactions

  • Environmental Condition Variation: Assess function under different pH, temperature, or osmotic conditions

  • Protein Modification Analysis: Check for post-translational modifications that might affect function

When working with uncharacterized transporters like YeaB, contradictory results often stem from unknown cofactor requirements or regulatory mechanisms. The complexity of membrane protein insertion and folding adds another layer of variability. Systematic documentation of experimental conditions and methodical variation of parameters can help identify factors contributing to contradictory results.

How can I utilize lifespan engineering to optimize expression of uncharacterized transporters?

Lifespan engineering represents a cutting-edge approach to improve recombinant protein production:

  • Chronological Lifespan Modification: Target genes affecting cell survival in stationary phase

    • Knockout of growth-related autolysis genes (lytC, sigD, pcfA, flgD) can increase biomass by 10-20%

    • Deletion of prophage-associated genes (xpf) can increase biomass by approximately 10%

    • Manipulation of spore-associated genes (skfA, sdpC, spoIIE) can increase biomass by 8-14%

  • Replicative Lifespan Engineering: Modify genes controlling cell division cycles

    • Affects cell morphology and division dynamics

    • Can alter mass transfer efficiency through changes in specific surface area

  • Combined Approach: Integrate both strategies for comprehensive cellular optimization

    • Enables increased biomass production

    • Improves tolerance to toxic substrates or products

    • Extends high-yield production periods

Recent research demonstrates that systematic modification of B. subtilis lifespan can create robust chassis cells with improved production capabilities. For uncharacterized transporters like YeaB, lifespan-engineered strains might offer advantages in expression yield and functional stability, particularly if the transporter affects cellular energy balance or membrane integrity.

What strategies can address challenges in structural studies of uncharacterized transporters?

Structural studies of membrane transporters present unique challenges that require specialized approaches:

  • Fusion Protein Strategies:

    • Insert stable, soluble proteins into flexible loops to improve crystallization properties

    • Use GFP fusions to monitor proper folding and membrane localization

    • Employ antibody fragment fusions to stabilize specific conformations

  • Detergent Optimization:

    • Systematic screening of detergents for extraction efficiency and protein stability

    • Use of novel amphipathic polymers (amphipols) or nanodiscs to maintain native-like environment

  • Computational Approaches:

    • Homology modeling based on structurally characterized transporters

    • Molecular dynamics simulations to predict conformational changes

    • Deep learning methods for structure prediction from sequence data

  • Functional Surface Mapping:

    • Systematic mutagenesis to identify functionally important residues

    • Accessibility studies using membrane-impermeable reagents

    • Cross-linking approaches to identify residue proximities

For uncharacterized transporters like YeaB, initial computational predictions combined with experimental validation can provide structural insights even before high-resolution structures are obtained. These approaches are particularly valuable for understanding transport mechanisms and substrate binding sites.

How does the cell wall composition of B. subtilis affect transporter functionality and experimental design?

The unique composition of the B. subtilis cell wall significantly impacts membrane protein studies:

  • Cell Wall Thickness Effects:

    • Overexpression of certain transporters (e.g., YtrBCDEF) can increase cell wall thickness

    • Thicker cell walls can affect genetic competence and biofilm formation

    • May impact accessibility of substrates to membrane transporters

  • Experimental Design Considerations:

    • Cell wall properties should be monitored when characterizing transporter function

    • Antibiotics targeting cell wall synthesis may induce expression of certain transporters

    • Extraction protocols must account for the thick peptidoglycan layer

  • Genetic Background Importance:

    • Mutations affecting cell wall properties (e.g., ytrA deletion) can alter multiple cellular processes

    • Complementation studies should consider these pleiotropic effects

    • Control strains should be carefully selected to account for cell wall variations

Research on the YtrBCDEF ABC transporter revealed that its overexpression increases cell wall thickness, which subsequently impacts competence development and biofilm formation . Similar effects might occur with other transporters, including YeaB, highlighting the importance of considering cell wall properties in experimental design and data interpretation.

What are common pitfalls in functional studies of uncharacterized transporters, and how can they be addressed?

Functional studies of novel transporters frequently encounter specific challenges:

ChallengeCausesSolutions
No detectable transport activityImproper folding, missing cofactors, wrong substrate testedTest multiple expression conditions, supplement potential cofactors, expand substrate range
High background in transport assaysEndogenous transporters, non-specific bindingUse deletion strains lacking similar transporters, optimize washing procedures
Inconsistent results between replicatesVariable expression levels, unstable proteinStandardize induction protocols, include internal controls, verify protein integrity
Growth defects upon expressionToxicity, metabolic burdenUse tightly regulated promoters, optimize induction timing and strength
Loss of expression over generationsGenetic instability, selection against toxic proteinIntegrate expression cassette into chromosome, verify sequence integrity regularly

For uncharacterized transporters like YeaB, the absence of knowledge about natural substrates presents a significant challenge. A methodical approach using substrate classes based on bioinformatic predictions, coupled with careful control experiments, can help overcome these limitations. Additionally, varying the expression system and genetic background can reveal host factors affecting transporter function.

How can I determine if my uncharacterized transporter requires specific lipid environments for optimal function?

Membrane protein function is often dependent on the lipid environment:

  • Lipid Composition Analysis:

    • Compare lipid profiles of native B. subtilis membranes to expression host membranes

    • Identify lipid species that co-purify with the transporter

    • Use mass spectrometry to analyze bound lipids

  • Functional Reconstitution:

    • Test transporter activity in liposomes with varying lipid compositions

    • Systematically vary cholesterol, phospholipid, and sphingolipid content

    • Measure activity as a function of membrane fluidity and thickness

  • Site-Directed Mutagenesis:

    • Identify potential lipid-binding sites through computational prediction

    • Mutate residues at lipid-protein interfaces and assess functional impact

    • Examine conservation of putative lipid-binding motifs across homologs

  • In vivo Approaches:

    • Express the transporter in strains with altered membrane composition

    • Use lipid biosynthesis inhibitors to modify membrane properties

    • Employ temperature shifts to alter membrane fluidity

Understanding the lipid requirements of uncharacterized transporters can provide insights into their regulatory mechanisms and physiological roles. For YeaB, comparing its function in different membrane environments might reveal specific lipid dependencies that could be exploited for functional characterization or optimization of expression conditions.

How can systems biology approaches enhance our understanding of uncharacterized transporters?

Systems biology offers powerful frameworks for studying novel transporters:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to identify potential substrates and regulatory networks

    • Map condition-specific expression patterns to infer physiological roles

    • Identify co-regulated genes that might function in related pathways

  • Genome-Scale Metabolic Modeling:

    • Incorporate transporter reactions into genome-scale metabolic models

    • Predict growth phenotypes under various conditions

    • Identify metabolic bottlenecks that might be addressed by the transporter

  • Synthetic Biology Applications:

    • Design synthetic circuits incorporating the transporter for specific applications

    • Use the transporter as a component in engineered metabolic pathways

    • Develop biosensors based on transporter specificity

  • Evolutionary Analysis:

    • Compare transporter distribution across bacterial species

    • Identify evolutionary pressures shaping transporter function

    • Reconstruct ancestral sequences to understand functional evolution

For uncharacterized transporters like YeaB, systems approaches can place them within the broader context of cellular metabolism and physiology. This holistic perspective can generate testable hypotheses about substrate specificity, regulation, and physiological role that might not be apparent from reductionist approaches alone.

What emerging technologies will impact future studies of uncharacterized transporters?

Several cutting-edge technologies are poised to revolutionize membrane transporter research:

  • Cryo-Electron Microscopy Advances:

    • Single-particle analysis for high-resolution structures

    • Tomography for visualizing transporters in native membranes

    • Time-resolved studies capturing transport cycles

  • Advanced Microscopy Techniques:

    • Super-resolution imaging of transporter distribution and dynamics

    • Single-molecule tracking to study mobility and clustering

    • FRET-based sensors to monitor conformational changes

  • High-Throughput Functional Screening:

    • Microfluidic platforms for rapid substrate screening

    • Transporter-specific biosensors for activity detection

    • Droplet-based assays for single-cell analysis

  • Computational Advances:

    • AlphaFold and similar AI approaches for structure prediction

    • Molecular dynamics simulations at extended timescales

    • Quantum mechanical modeling of transport processes

  • Genome Engineering Tools:

    • CRISPR-based screening to identify genetic interactions

    • Precise genome editing for tag insertion at native loci

    • Multiplexed mutagenesis for comprehensive structure-function analysis

These technologies will enable more comprehensive characterization of transporters like YeaB, potentially accelerating the path from sequence to function and revealing unexpected roles in cellular physiology.

What are the most promising research directions for characterizing YeaB and similar uncharacterized transporters?

Based on current knowledge and technological capabilities, several research directions appear particularly promising:

  • Integrated Phenotypic Screening:

    • Systematic growth phenotyping under diverse conditions

    • Metabolite profiling in wild-type vs. overexpression/deletion strains

    • Stress resistance characterization to identify physiological roles

  • Structural Biology Approaches:

    • Initial computational modeling based on homologous transporters

    • Strategic mutagenesis guided by structural predictions

    • Gradual progression toward high-resolution structural studies

  • Multi-organism Comparative Studies:

    • Analysis of YeaB homologs across bacterial species

    • Complementation studies in heterologous hosts

    • Identification of conserved vs. species-specific functions

  • Application-Driven Investigation:

    • Exploration of biotechnological applications based on predicted function

    • Testing roles in metabolic engineering scenarios

    • Evaluation as potential drug targets or biosensor components

Researchers should adopt a multifaceted approach, combining computational predictions with systematic experimental validation. For YeaB specifically, leveraging knowledge from better-characterized B. subtilis transporters while employing modern high-throughput methods represents the most efficient path toward functional characterization.

How should researchers prioritize efforts when working with completely uncharacterized transporters?

A strategic approach to uncharacterized transporter research includes:

  • Initial Characterization Phase (0-6 months):

    • Comprehensive bioinformatic analysis to predict family, topology, and potential substrates

    • Expression optimization in multiple systems

    • Basic transport assays with predicted substrate classes

    • Phenotypic characterization of deletion/overexpression strains

  • Detailed Functional Analysis (6-18 months):

    • Refined substrate specificity determination

    • Transport kinetics and energetics characterization

    • Mutagenesis of predicted functional residues

    • Initial structural studies (modeling, low-resolution experimental approaches)

  • Mechanistic Investigation (18-36 months):

    • Advanced structural studies if functional data warrants

    • Detailed transport mechanism elucidation

    • Regulatory network mapping

    • Physiological role determination

  • Application Development (24+ months):

    • Exploration of biotechnological applications

    • Engineering for improved/altered function

    • Integration into synthetic biology systems

This staged approach allows for efficient resource allocation and enables critical decision points where projects can be redirected based on emerging data. For transporters like YeaB, early results should guide whether to pursue detailed mechanistic studies or focus on practical applications of the discovered function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.