Recombinant Bacillus subtilis Uncharacterized transporter YrhG (yrhG)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant YrhG refers to genetically engineered versions of the Bacillus subtilis YrhG transporter produced in heterologous expression systems. Key characteristics include:

  • Gene Name: yrhG (synonymous with yrhg in some sources) .

  • Classification: Member of the formate/nitrite transporter family .

  • Structure: Predicted transmembrane domains typical of secondary active transporters, though no resolved 3D structure is available.

Recombinant Production and Purification

YrhG is commercially produced using various expression hosts, with technical specifications detailed below:

Table 1: Recombinant YrhG Variants

Product CodeHost SystemTagPurityProtein Length
RFL35531BF E. coliHis≥85%Full-length (1–266 aa)
YRHG-2015B E. coli/YeastHis≥85%Unspecified
MBS7035496 Cell-Free ExpressionNone≥85%Partial

Key Notes:

  • Host Flexibility: YrhG is expressible in E. coli, yeast, and cell-free systems, reflecting adaptability to diverse platforms .

  • Purification: Achieved via affinity chromatography (e.g., His-tag) .

Putative Substrate Specificity

  • Formate/Nitrite Transport: Annotated as a formate/nitrite transporter, implicating roles in anaerobic respiration or nitrogen metabolism .

  • Comparative Analysis: ABC transporters like YtrBCDEF in B. subtilis influence cell wall biosynthesis and antibiotic resistance , while YclNOPQ mediates siderophore uptake . YrhG’s classification distinguishes it from these ATP-driven systems.

Pathway Associations

  • YrhG is linked to unspecified metabolic pathways, though no direct interactions or regulatory networks are documented .

Expression Systems in B. subtilis

  • Secretion Pathways: B. subtilis employs Sec and Tat systems for protein export . While YrhG is typically cytoplasmic in recombinant forms, its native secretion mechanism (if any) remains uncharacterized.

  • Industrial Relevance: B. subtilis is a GRAS organism favored for recombinant protein production due to high secretion capacity and genetic tractability .

Research Applications

  • Model Studies: YrhG serves as a subject for transporter mechanism exploration, particularly in anaerobic environments.

  • Tool Development: Its recombinant production aids in antibody generation or structural studies .

Knowledge Gaps and Future Directions

  • Functional Characterization: Detailed substrate profiling and knockout studies are needed to elucidate YrhG’s physiological role.

  • Structural Biology: Cryo-EM or crystallography could resolve its architecture and transport mechanism.

  • Comparative Genomics: Ortholog analysis across Bacillus species may reveal conserved or divergent functions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
yrhG; BSU27200; Uncharacterized transporter YrhG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yrhG
Target Protein Sequence
MAFRKPDEIAEAAIEAGMKKIKLPLPSLLVLGFLGGAFIALGYLLDIRVIGDLPKEWGSLSSLIGAAVFPVGLILVVLAGAELITGNMMSVAMALFSRKISVKELAINWGIVTIMNLIGALFVAYFFGHLVGLTETGPYLEKTIAVAQGKLDMSFGKVLISAIGCNWLVCLAVWLSFGAQDAAGKILGIWFPIMAFVAIGFQHVVANMFVIPAAIFAGSFTWGQFIGNIIPAFIGNVIGGAVFVGLIYFIAYHKKDRSRKEMKQVS
Uniprot No.

Target Background

Database Links
Protein Families
FNT transporter (TC 2.A.44) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the yrhG transporter in Bacillus subtilis?

The yrhG protein is classified as an uncharacterized transporter in Bacillus subtilis, indicating limited functional characterization to date. As of April 2025, it remains among the significant portion of the B. subtilis proteome that requires further investigation. Comprehensive proteome studies have identified thousands of proteins in B. subtilis, yet functional characterization lags behind for many transporters, including yrhG . Recent proteome mapping efforts have covered approximately 75% of the theoretical B. subtilis proteome (3,159 proteins), providing a foundation for further targeted studies of specific proteins like yrhG .

What expression systems are recommended for recombinant yrhG production?

For recombinant expression of yrhG, several B. subtilis-based expression systems can be employed. A notable approach involves mimicking the serine alkaline protease synthesis and secretion pathway. This system typically utilizes a hybrid gene construction, combining a signal (pre-) DNA sequence (such as the B. licheniformis serine alkaline protease gene subC) with the cDNA encoding the target protein . For optimal expression, vectors like pMK4 under the control of a deg-promoter have demonstrated success with other recombinant proteins in B. subtilis, yielding concentrations of up to 70 mg/L in glucose-based defined media . This system offers the advantage of proper processing by B. subtilis signal-peptidase, ensuring correct maturation of the expressed protein.

What post-translational modifications should be considered when studying yrhG?

When investigating yrhG, researchers should account for potential post-translational modifications that may affect protein function. Recent comprehensive studies on the B. subtilis proteome have detected 1,085 phosphorylation sites and 4,893 lysine acetylation sites across various proteins . For membrane transporters like yrhG, phosphorylation often regulates activity, localization, and protein-protein interactions. Methodologically, researchers should employ phosphoproteomics approaches that combine enrichment techniques (e.g., titanium dioxide chromatography) with mass spectrometry to identify modification sites. Additionally, acetylation may influence protein stability and function, requiring techniques like immunoprecipitation with anti-acetyllysine antibodies followed by mass spectrometric analysis.

How can evolutionary analysis inform functional hypotheses about yrhG?

Evolutionary analysis provides crucial context for uncharacterized proteins like yrhG. Genomic phylostratigraphy can help gauge the evolutionary age of yrhG relative to other B. subtilis proteins . This approach involves:

  • Sequence homology searches across diverse bacterial genomes

  • Construction of phylogenetic trees to identify orthologs

  • Determination of conservation patterns across different bacterial phyla

Research has revealed that many post-translational modifications appear on evolutionarily older bacterial proteins , suggesting functional importance. For yrhG, identifying highly conserved domains across related species can highlight functionally significant regions. Furthermore, comparing yrhG to characterized transporters in other bacteria may provide functional insights through the principle of homology.

What are the optimal approaches for determining the substrate specificity of yrhG?

Determining substrate specificity for an uncharacterized transporter requires a multi-faceted approach:

MethodologyTechnical ApproachAdvantagesLimitations
Radiolabeled substrate transportMeasure uptake/efflux of candidate substrates using radiolabeled compoundsDirect measurement of transport activityRequires hypothesis about potential substrates
Metabolomics profilingCompare metabolite profiles between wild-type and yrhG mutant strainsCan identify unexpected substratesSecondary effects may confound results
Genetic approachesComplementation studies in transporter-deficient strainsDemonstrates functional replacementLimited to known transporter functions
Structural modelingIn silico prediction based on homology to characterized transportersNon-invasive initial screeningRequires validation through wet-lab experiments

A comprehensive strategy would involve initial in silico predictions based on structural similarities to known transporters, followed by metabolomic screening to narrow down candidate substrates, and finally direct transport assays using radiolabeled compounds to confirm specificity .

How should researchers approach the transcriptional regulation analysis of yrhG?

Understanding transcriptional regulation of yrhG requires temporal profiling of expression under various conditions. Time-resolved transcriptome analysis using custom microarrays representing the B. subtilis genome can reveal expression patterns in response to environmental stimuli . Researchers should:

  • Design experiments with multiple time points following exposure to different growth conditions

  • Analyze promoter regions for potential regulatory motifs

  • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the yrhG promoter

  • Validate findings with reporter gene assays

Pay particular attention to sigma factor involvement, as B. subtilis employs multiple sigma factors (SigB, SigD, SigK, SigW, SigE, SigH) that regulate distinct gene sets under specific conditions . Determination of which sigma factor regulates yrhG can provide significant functional insights.

What proteomics techniques are most effective for studying yrhG localization and interactions?

For comprehensive characterization of yrhG localization and protein interactions, employ the following proteomics approaches:

Subcellular Fractionation and Western Blotting:

  • Separate membrane fractions (inner and outer membrane for Gram-positive bacteria)

  • Perform Western blot analysis using anti-yrhG antibodies or epitope tags

  • Compare localization under different growth conditions

Interactome Analysis:

  • Implement affinity purification coupled with mass spectrometry (AP-MS)

  • Use CRISPR-based proximity labeling (e.g., TurboID) to identify proximal proteins

  • Validate interactions through co-immunoprecipitation and bacterial two-hybrid assays

Cross-linking Mass Spectrometry (XL-MS):
For capturing transient interactions and structural information, employ chemical cross-linking followed by mass spectrometry analysis. This approach has been successfully used to map protein-protein interactions in B. subtilis and can provide valuable insights into the functional partners of yrhG.

How can CRISPR-Cas9 be optimized for genetic manipulation of yrhG in B. subtilis?

For precise genetic manipulation of yrhG, CRISPR-Cas9 offers significant advantages over traditional methods:

  • Guide RNA Design: Select target sequences with minimal off-target effects using algorithms specifically optimized for B. subtilis genomic context

  • Delivery Method: Transform B. subtilis with a two-plasmid system - one expressing Cas9 and another containing the guide RNA and homology repair template

  • Screening Strategy: Implement a two-step selection process using appropriate antibiotic markers

For point mutations or epitope tagging of yrhG, design homology arms of at least 500 bp on each side of the target site to ensure efficient homologous recombination. When deleting yrhG, consider potential polar effects on adjacent genes and include appropriate controls in subsequent phenotypic analyses.

To enhance efficiency, co-express DNA recombination proteins (e.g., RecA) to increase homology-directed repair rates. Validate all modifications by sequencing and confirm protein expression/absence through Western blotting.

What methods are appropriate for assessing yrhG function in biofilm formation and stress response?

Transport proteins often play crucial roles in biofilm formation and stress responses. To assess yrhG function in these processes:

Biofilm Formation Assays:

  • Quantify biofilm formation using crystal violet staining in wild-type vs. yrhG mutant strains

  • Employ confocal microscopy with fluorescent reporters to visualize biofilm architecture

  • Analyze extracellular matrix composition through biochemical assays

Stress Response Evaluation:

  • Subject wild-type and yrhG-deficient strains to various stressors (oxidative, osmotic, temperature)

  • Monitor growth curves, survival rates, and morphological changes

  • Perform transcriptome analysis to identify differentially expressed genes in response to stress

For phenotypic complementation studies, express yrhG under inducible promoters to confirm observed phenotypes are directly attributable to yrhG function rather than polar effects. This approach has been successfully used to characterize functional roles of other B. subtilis proteins .

How should researchers interpret conflicting data about yrhG function?

When encountering conflicting data regarding yrhG function, implement a systematic troubleshooting approach:

  • Evaluate Experimental Conditions:

    • Catalog differences in media composition, growth phase, and environmental parameters

    • Reproduce experiments under standardized conditions across different laboratories

  • Consider Strain Variation:

    • Sequence the yrhG locus and surrounding regions in all strains used

    • Develop isogenic strains specifically for comparative analyses

  • Assess Methodological Differences:

    • Compare detection limits and sensitivity of different analytical techniques

    • Evaluate whether in vitro versus in vivo approaches might explain discrepancies

  • Functional Redundancy Analysis:

    • Investigate potential compensatory mechanisms by other transporters

    • Create multiple knockout strains to identify functional overlap

Multiple B. subtilis proteins may have overlapping functions, as demonstrated with the LtaS-type proteins where unexpected enzymatic interdependency was observed . A similar phenomenon may exist among transporters, requiring careful experimental design to deconvolute individual contributions.

What statistical approaches are recommended for analyzing yrhG expression data?

For robust statistical analysis of yrhG expression data:

  • Normalization Strategies:

    • Apply appropriate normalization methods (e.g., RPKM/FPKM for RNA-seq or quantile normalization for microarray data)

    • Include multiple housekeeping genes as internal controls

  • Differential Expression Analysis:

    • Utilize DESeq2 or edgeR for RNA-seq data

    • Apply Bayesian methods to account for technical and biological variability

  • Time-Series Analysis:

    • Implement STEM (Short Time-series Expression Miner) for temporal patterns

    • Use functional clustering to identify co-regulated genes

  • Validation Approaches:

    • Confirm expression changes through qRT-PCR

    • Correlate transcript levels with protein abundance using targeted proteomics

When analyzing temporal expression profiles, similar to those described for B. subtilis , apply appropriate statistical models that account for time-dependent correlations in the data. Multi-factorial experimental designs should be analyzed using ANOVA models with post-hoc corrections for multiple testing.

How can researchers integrate multi-omics data to develop comprehensive models of yrhG function?

Integrating multiple omics datasets provides a holistic view of yrhG function:

  • Data Integration Workflow:

    • Implement a consistent experimental design across omics platforms

    • Develop computational pipelines that normalize and harmonize diverse data types

    • Apply network analysis to identify functional modules and relationships

  • Multi-layer Network Construction:

    • Build networks connecting transcriptomic, proteomic, and metabolomic data

    • Identify hub molecules that bridge different functional layers

    • Apply machine learning algorithms to predict functional relationships

  • Validation Strategy:

    • Prioritize predictions for experimental validation based on network centrality

    • Design targeted experiments to test specific hypotheses generated from integrated models

    • Iteratively refine models based on experimental feedback

Recent proteogenomic analyses in B. subtilis have successfully mapped MS spectra onto six-frame translations of the genome, leading to the discovery of novel ORFs . Similar approaches could reveal previously unrecognized functional elements related to yrhG regulation or activity.

What emerging technologies hold promise for characterizing yrhG and similar uncharacterized transporters?

Several cutting-edge technologies show significant potential for advancing our understanding of uncharacterized transporters like yrhG:

  • Cryo-Electron Microscopy:

    • Enables determination of membrane protein structures in near-native environments

    • Recent advances in sample preparation and image processing have improved resolution for membrane proteins

    • Allows visualization of conformational changes during transport cycles

  • Single-Molecule Tracking:

    • Provides insights into transporter dynamics in living cells

    • Can reveal clustering behavior and association with specific membrane microdomains

    • Offers temporal resolution to capture transport kinetics

  • Nanopore Technology:

    • Can be adapted to study single transporter molecules incorporated into artificial membranes

    • Enables direct electrophysiological measurement of transport activity

    • Allows screening of potential substrates with high sensitivity

These technologies, combined with traditional biochemical and genetic approaches, will provide comprehensive insights into the structure, function, and regulation of yrhG in B. subtilis cellular physiology.

How might comparative analysis across Bacillus species inform yrhG characterization?

Comparative genomic analysis across Bacillus species provides an evolutionary framework for understanding yrhG:

  • Ortholog Identification:

    • Survey the presence and sequence conservation of yrhG across diverse Bacillus species

    • Identify species-specific variations that might correlate with ecological niches

    • Construct phylogenetic trees to trace the evolutionary history of the transporter

  • Synthetic Biology Approaches:

    • Express yrhG orthologs from different species in a common B. subtilis background

    • Assess functional complementation to identify conserved and divergent activities

    • Engineer chimeric proteins to map functionally important domains

  • Ecological Context Analysis:

    • Correlate yrhG sequence variations with species-specific environmental adaptations

    • Examine expression patterns across species in response to common stimuli

    • Identify conserved regulatory mechanisms governing transporter expression

This comparative approach has proven valuable in characterizing other B. subtilis proteins, revealing evolutionary insights into functional annotation as demonstrated in comprehensive proteome studies .

What are the implications of yrhG research for broader understanding of bacterial transporters?

Research on uncharacterized transporters like yrhG contributes significantly to our understanding of bacterial physiology and evolution. By elucidating the function and regulation of this protein, researchers advance knowledge in several key areas:

  • Transporter Classification Systems:

    • Refining functional categories based on empirical data rather than sequence homology alone

    • Identifying novel transport mechanisms that may challenge existing paradigms

    • Developing improved prediction algorithms for transporter function

  • Bacterial Adaptation Mechanisms:

    • Understanding how transporter diversity contributes to niche adaptation

    • Elucidating the role of transporters in stress responses and environmental sensing

    • Revealing evolutionary strategies for resource acquisition in different environments

  • Biotechnological Applications:

    • Informing the design of engineered strains with enhanced substrate utilization

    • Providing targets for improving recombinant protein production systems in B. subtilis

    • Contributing to the development of biosensors based on transporter specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.