Recombinant Bacillus subtilis Uncharacterized transporter YwcJ (ywcJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please include them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ywcJ; BSU38060; ipa-48r; Uncharacterized transporter YwcJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywcJ
Target Protein Sequence
METQALQKVEQYALKKQNIFASSKIRYVLRSILASIFIGFGITAASKTGSYFFMADSPFAFPAAAVTFGAAILMIAYGGGDLFTGNTFYFTYTALRKKISWRDTLYLWMSSYAGNLIGAILFAILISATGLFEEPSVHSFLIHLAEHKMEPPASELFFRGMLCNWLVCLAFFIPMSLKGEGAKLFTMMLFVFCFFISGFEHSIANMCTFAISLLIEHPDTVTLMGAVRNLIPVTLGNLTAGIVMMGWMYYTLNPDQ
Uniprot No.

Target Background

Database Links
Protein Families
FNT transporter (TC 2.A.44) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YwcJ and where is it found in Bacillus subtilis?

YwcJ is an uncharacterized membrane transporter protein found in Bacillus subtilis strain 168. It is encoded by the ywcJ gene (locus tag: BSU38060, also known as ipa-48r) and consists of 256 amino acids . The protein is predicted to have multiple transmembrane domains based on its hydrophobic amino acid sequence, which is characteristic of membrane transporters . As part of the B. subtilis membrane proteome, YwcJ is one of many transporters that potentially contribute to the bacterium's adaptability to various environmental conditions .

How does YwcJ compare to other transporters in Bacillus subtilis?

YwcJ belongs to the extensive collection of membrane transporters in B. subtilis, but remains functionally uncharacterized compared to well-studied transporters in this organism. Unlike characterized transporters such as those involved in sugar uptake or ion transport, YwcJ's substrate specificity and transport mechanism remain to be elucidated .

Sequence comparison analyses suggest that YwcJ may have a role in the SacP-SacT-YwcJ system, as it is genetically linked to these proteins in the B. subtilis genome . The sacA-sacP-sacT-ywcJ region shows significant sequence heterogeneity between different B. subtilis strains (particularly between the 168 and W23 lineages), suggesting possible functional specialization or adaptation .

What expression systems are most effective for producing recombinant YwcJ?

  • Expression vectors: pET series vectors with T7 promoter systems offer controlled, high-level expression. For membrane proteins, vectors with lower expression rates or inducible systems like pBAD may reduce toxicity.

  • Host strains: E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), are recommended as they have adaptations to tolerate membrane protein overexpression.

  • Fusion tags: N-terminal fusion tags like His6, MBP, or SUMO can improve solubility and facilitate purification. For YwcJ, a His-tag would enable purification via nickel affinity chromatography while minimizing interference with protein function .

  • Expression conditions: Lowering the expression temperature (16-20°C) after induction and using lower inducer concentrations can improve the yield of correctly folded protein.

  • Alternative systems: For functional studies, considering the native host (B. subtilis) as an expression platform may provide advantages in terms of correct folding and post-translational modifications.

What are the optimal methods for purifying recombinant YwcJ while maintaining its native conformation?

Purification of membrane transporters like YwcJ requires specialized approaches to maintain the protein in its native conformation:

Recommended purification protocol:

  • Membrane preparation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization:

    • Resuspend membrane fraction in buffer containing mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations of 1-2%

    • Incubate with gentle agitation at 4°C for 1-2 hours

  • Affinity purification:

    • Load solubilized fraction onto affinity resin (Ni-NTA for His-tagged YwcJ)

    • Wash with buffer containing low concentrations of detergent (0.05-0.1%) to maintain protein solubility

    • Elute with imidazole gradient (20-500 mM)

  • Further purification:

    • Size exclusion chromatography using Superdex 200 in buffer containing 0.03-0.05% detergent

    • For higher purity, consider ion exchange chromatography as an additional step

Throughout purification, maintain a stable environment with protective additives (glycerol 10%, reducing agents) and work at 4°C to minimize protein denaturation and aggregation.

How can functional assays be designed to characterize the transport activity of YwcJ?

Designing functional assays for an uncharacterized transporter like YwcJ requires a systematic approach to identifying its substrates and characterizing its transport mechanism:

  • Substrate identification approaches:

    • Radioisotope uptake assays using proteoliposomes reconstituted with purified YwcJ

    • Fluorescent substrate analogs with real-time fluorescence monitoring

    • Metabolomic profiling of wild-type vs. ywcJ knockout strains

    • Transport assays with potential substrates based on genetic context (connection to SacP-SacT suggests possible involvement in sugar transport)

  • Biophysical characterization:

    • Electrophysiology (patch-clamp) if ion transport is suspected

    • Membrane potential sensitive dyes for detecting electrogenic transport

    • Isothermal titration calorimetry (ITC) to measure substrate binding affinities

  • Experimental design for transport assays:

    • Reconstitute YwcJ into proteoliposomes with defined lipid composition

    • Establish pH or ion gradients across the membrane

    • Monitor substrate uptake/export over time using appropriate detection methods

    • Include controls: empty liposomes, liposomes with inactive YwcJ mutants

  • Kinetic analysis:

    • Determine transport rates at various substrate concentrations

    • Calculate Km and Vmax values to characterize transport efficiency

    • Investigate potential inhibitors and competitive substrates

How is the ywcJ gene regulated in Bacillus subtilis?

The regulation of the ywcJ gene in B. subtilis involves several mechanisms based on available research:

  • Transcriptional regulation: The ywcJ promoter region contains a Fnr binding site, indicating oxygen-dependent regulation . Research has shown that the consensus Fnr binding site (TGTGA-TA-TCACA) in the ywcJ promoter region can be experimentally modified (to CCTGA-TA-TCACA), affecting its regulation .

  • Genetic context: The ywcJ gene is genetically linked to the sacP-sacT system, suggesting potential co-regulation with genes involved in sugar metabolism . This genomic organization may indicate a functional relationship between these genes.

  • Strain-specific variation: The regulatory elements controlling ywcJ expression show heterogeneity between different B. subtilis strains, particularly between the 168 and W23 lineages . In strain PY79, the entire sacA-sacP-sacT-ywcJ region derives from the W23 lineage rather than the 168 lineage, indicating significant evolutionary divergence in the regulation of this genomic region.

  • Experimental approaches to study regulation:

    • Reporter gene fusions (ywcJ-lacZ) can be used to monitor expression levels under different conditions

    • Chromatin immunoprecipitation (ChIP) can identify transcription factors binding to the ywcJ promoter

    • RNA-seq analysis can reveal transcriptional responses to various environmental stresses

What is the evolutionary conservation of YwcJ across Bacillus species and other bacteria?

YwcJ shows interesting patterns of evolutionary conservation and divergence:

  • Intraspecies variation: Significant sequence diversity exists between different B. subtilis strains. The W23 and 168 lineages show distinct sequence variations in the ywcJ gene and surrounding genomic regions, suggesting possible functional specialization .

  • Conservation in Bacillus genus: Homologs of YwcJ can be found across various Bacillus species, though with varying degrees of sequence identity. This conservation suggests a fundamental role in Bacillus physiology.

  • Wider taxonomic distribution: YwcJ homologs are primarily restricted to the Firmicutes phylum, with more distant homologs showing lower sequence identity but potentially conserved structural features.

  • Evolutionary analysis approaches:

    • Multiple sequence alignment of YwcJ homologs can identify conserved residues critical for function

    • Phylogenetic analysis can reveal evolutionary relationships and potential functional divergence

    • Analysis of selection pressure on different protein domains can highlight functionally important regions

This evolutionary pattern suggests that YwcJ likely plays a specialized role in Bacillus physiology, potentially related to the unique ecological niches these bacteria occupy.

How can CRISPR-Cas9 genome editing be optimized for studying ywcJ function in Bacillus subtilis?

CRISPR-Cas9 genome editing in B. subtilis requires specialized approaches to achieve high efficiency when targeting genes like ywcJ:

  • Guide RNA design for ywcJ:

    • Select target sequences with minimal off-target effects

    • Verify PAM sites (NGG for SpCas9) in the ywcJ sequence

    • Design sgRNAs targeting conserved functional domains for knockout studies

    • For point mutations or tagging, design sgRNAs near the desired modification site

  • Delivery system optimization:

    • Plasmid-based systems: Use vectors compatible with B. subtilis like pHT01-based constructs

    • Integrate the cas9 gene under an inducible promoter to control expression levels

    • Deliver repair templates as ssDNA oligonucleotides for small changes or plasmids for larger insertions

  • Editing strategies for functional studies:

    • Gene inactivation: Create frameshift mutations or premature stop codons

    • Domain analysis: Make precise deletions of predicted functional domains

    • Reporter fusions: Insert fluorescent protein tags for localization studies

    • Regulatable expression: Introduce inducible promoters to control ywcJ expression

  • Screening and validation approaches:

    • Design PCR primers flanking the target region to verify edits

    • Use restriction enzyme digestion for rapid screening if the edit creates/removes a restriction site

    • Sequence verification of multiple clones to rule out off-target effects

    • Phenotypic characterization to confirm functional consequences

What structural biology approaches are most suitable for determining the three-dimensional structure of YwcJ?

Determining the structure of membrane proteins like YwcJ presents unique challenges. Several complementary approaches are recommended:

  • X-ray crystallography:

    • Requires milligram quantities of pure, homogeneous protein

    • Screening of detergents and lipidic cubic phase (LCP) methods for crystal formation

    • Use of fusion partners like T4 lysozyme to enhance crystallization

    • Challenges: Obtaining diffraction-quality crystals is particularly difficult for membrane proteins

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly powerful for membrane protein structure determination

    • Requires less protein than crystallography (μg quantities)

    • No crystallization required, protein visualized in a near-native environment

    • Challenges: Protein size (YwcJ at ~28 kDa may be too small without additional strategies)

  • NMR spectroscopy:

    • Solution NMR: Suitable for smaller membrane proteins in detergent micelles

    • Solid-state NMR: Can analyze proteins in native-like lipid environments

    • Provides dynamic information not available from static structures

    • Challenges: Isotope labeling (13C, 15N) required, complex spectral assignment

  • Integrative structural biology approaches:

    • Combine low-resolution experimental data with computational modeling

    • Validate models using biochemical and biophysical experiments

    • Cross-link mass spectrometry can provide distance constraints

    • Molecular dynamics simulations to explore conformational dynamics

How does YwcJ contribute to the physiology and stress response of Bacillus subtilis?

Understanding the physiological role of YwcJ requires comprehensive experimental approaches:

  • Comparative phenotypic analysis:

    • Growth curve analysis of wild-type vs. ΔywcJ strains under various conditions

    • Stress response profiling (temperature, pH, osmotic, oxidative)

    • Nutrient limitation experiments to identify potential transport substrates

    • Biofilm formation assays to assess community behavior implications

  • Transcriptomic and proteomic responses:

    • RNA-seq analysis comparing wild-type and ΔywcJ strains

    • Quantitative proteomics to identify compensatory changes

    • Metabolomic profiling to detect accumulated/depleted metabolites

    • ChIP-seq to identify regulatory networks affected by YwcJ absence

  • Integration with B. subtilis physiology:

    • Based on genetic context, YwcJ may be involved in sugar transport or metabolism

    • The protein may contribute to membrane potential maintenance or ion homeostasis

    • Potential role in biofilm formation, given B. subtilis' complex developmental cycles

    • Possible involvement in stress response pathways, particularly under oxygen limitation conditions based on Fnr regulation

  • Experimental design considerations:

    • Include appropriate controls: complemented mutant strains, point mutations affecting specific functions

    • Test various environmental conditions reflecting B. subtilis' natural habitats

    • Combine genetic approaches with biochemical validation

    • Consider strain-specific effects due to the known variation in YwcJ sequence between strains

How does YwcJ function integrate with known transporters and metabolic pathways in Bacillus subtilis?

The integration of YwcJ with established B. subtilis transport systems requires investigation along several lines:

  • Metabolic context analysis:

    • Based on its genetic linkage to the sacP-sacT region, YwcJ may participate in carbohydrate transport or metabolism

    • Metabolic flux analysis comparing wild-type and ΔywcJ strains can reveal affected pathways

    • Isotope labeling experiments can trace specific metabolite movement and processing

  • Transport system integration:

    Transport System TypePotential YwcJ InteractionExperimental Approach
    Sugar transportersMay function with or complement SacPSubstrate competition assays
    Ion transportersCould maintain ion gradients for secondary transportMembrane potential measurements
    Nutrient uptake systemsPossible role in specific nutrient acquisitionGrowth on defined media
    Efflux systemsPotential role in export of metabolites/toxinsResistance profile testing
  • Protein-protein interaction studies:

    • Bacterial two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation with tagged YwcJ to pull down complexes

    • FRET/BRET approaches to monitor interactions in living cells

    • Crosslinking mass spectrometry to map protein interaction interfaces

  • Compensation and redundancy:

    • Identify transporters with increased expression in ΔywcJ strains

    • Generate multiple knockout strains to reveal functional redundancy

    • Screen transporter libraries for suppression of ywcJ deletion phenotypes

What role might YwcJ play in Bacillus subtilis biofilm formation and sporulation?

B. subtilis is known for its complex developmental processes, and YwcJ may contribute to these processes in several ways:

  • Biofilm formation analysis:

    • Compare biofilm architecture between wild-type and ΔywcJ strains

    • Analyze extracellular matrix composition for changes

    • Monitor expression of ywcJ during biofilm development using fluorescent reporters

    • Test for altered biofilm phenotypes under various environmental stresses

  • Sporulation process involvement:

    • Monitor sporulation efficiency in ywcJ mutants

    • Track ywcJ expression throughout the sporulation cycle

    • Examine spore resistance properties in the absence of functional YwcJ

    • Investigate potential role in nutrient transport during spore formation

  • Spatial and temporal distribution:

    • Fluorescent protein fusions to visualize YwcJ localization during development

    • Time-lapse microscopy to track dynamic changes in localization

    • Super-resolution microscopy to precisely map membrane distribution patterns

    • Correlation with other developmental markers

  • Signaling pathway integration:

    • Epistasis analysis with known biofilm and sporulation regulators

    • Phosphorylation state analysis of two-component systems

    • Second messenger (c-di-GMP, c-di-AMP) measurements in ywcJ mutants

How can systems biology approaches be used to place YwcJ in the context of the complete Bacillus subtilis interactome?

Systems biology offers powerful tools to understand YwcJ's role in the broader context of B. subtilis biology:

  • Network analysis approaches:

    • Construct protein-protein interaction networks including YwcJ

    • Analyze genetic interaction networks from large-scale knockout studies

    • Map metabolic networks affected by ywcJ deletion

    • Integrate transcriptomic data to identify co-regulated gene clusters

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use computational tools to identify emergent patterns across datasets

    • Develop predictive models of YwcJ function based on multi-omics signatures

    • Validate model predictions with targeted experiments

  • Quantitative modeling:

    • Develop mathematical models of transport kinetics

    • Include YwcJ in genome-scale metabolic models of B. subtilis

    • Simulate cellular responses to various perturbations

    • Refine models based on experimental validation

  • Comparative systems biology:

    • Compare system-wide effects of ywcJ modifications across multiple B. subtilis strains

    • Analyze differences between laboratory strains (168, PY79) and wild isolates (NCIB 3610)

    • Evaluate conservation of YwcJ-dependent networks across Bacillus species

    • Place findings in evolutionary context using comparative genomics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.