Recombinant Bacillus subtilis Uncharacterized transporter YwrA (ywrA)

Shipped with Ice Packs
In Stock

Description

Biological Role of YwrA in B. subtilis

YwrA is part of the YwrBA transporter system, which functions as a chromate efflux pump. Key insights include:

  • Chromate Resistance: YwrA (annotated as Chr3C) and YwrB (Chr3N) form a short-chain chromate ion transporter that extrudes toxic chromate ions from B. subtilis cells .

  • Operon Structure: The ywrBA operon is regulated under chromate stress, with YwrA serving as the permease component of the transporter .

  • Functional Redundancy: ywrBA deletion mutants exhibit heightened sensitivity to chromate, confirming its role in metal detoxification .

Recombinant YwrA: Production and Applications

Recombinant YwrA is generated using B. subtilis expression systems, leveraging its GRAS (Generally Recognized as Safe) status and well-characterized secretion pathways .

  • Commercial Availability: MyBioSource offers a recombinant partial YwrA protein (MBS7069911) for research applications, though structural and functional details remain uncharacterized .

  • Expression Systems:

    • Plasmid-Based Cloning: The ywrA gene is cloned into integrative vectors (e.g., pSG1729) under native or constitutive promoters .

    • Secretion Pathways: Recombinant YwrA can be secreted via Sec or Tat systems in B. subtilis, though its transmembrane topology may necessitate optimization .

Genetic and Functional Studies

StudyKey FindingSource
Chromate efflux assayYwrBA transporters reduce intracellular chromate levels, enhancing survival under Cr(VI) stress.
ywrBA deletionΔywrBA strains show impaired growth in 0.5 mM Cr(VI), rescued by heterologous chrA expression.
Structural homologyYwrA shares 42–90% sequence homology with chromate transporters in B. cereus and Lysinibacillus fusiformis.

Biotechnological Relevance

  • Bioremediation: Engineered B. subtilis strains expressing YwrA homologs (e.g., B. pseudomycoides ChrA) show enhanced chromate tolerance, aiding environmental cleanup .

  • Pathogen Modeling: Orthologs of YwrA in pathogenic Bacillus species (e.g., B. anthracis) are potential antibacterial targets .

Challenges and Future Directions

  • Functional Characterization: The recombinant YwrA’s partial structure limits mechanistic studies; full-length expression and crystallization are needed .

  • Regulatory Networks: Further studies on ywrBA operon regulation under metal stress could optimize industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ywrA; BSU36130; Uncharacterized transporter YwrA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywrA
Target Protein Sequence
MISIYLFMAFFIANLLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIAT KIAAYVGYSAGGWPGFLIALIATVVPSALALIVLLRIIQRFRQSPVIKGMTLSVQPVIAV MMLILTWQIGADGIKAIGWVQSIVITGISLLAMTKFKMHPAFLIIAAFLYGGLVIPYL
Uniprot No.

Target Background

Database Links
Protein Families
Chromate ion transporter (CHR) (TC 2.A.51) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YwrA transporter in Bacillus subtilis?

YwrA is an uncharacterized membrane transporter protein encoded by the ywrA gene in Bacillus subtilis. While its specific function remains to be fully elucidated, it is predicted to belong to a family of bacterial transporters involved in nutrient acquisition or xenobiotic efflux. Based on comparative analyses with characterized transporters such as the YclNOPQ system, which functions as a petrobactin transporter in B. subtilis, YwrA likely plays a role in the transport of specific substrates across the bacterial cell membrane . The protein may be involved in iron acquisition pathways, similar to other characterized transporters in B. subtilis that contribute to iron homeostasis and potentially bacterial virulence.

What expression systems are most effective for producing recombinant YwrA protein?

For expression of recombinant YwrA, several systems can be employed based on methodologies used for similar membrane proteins:

Expression SystemAdvantagesDisadvantagesOptimal Conditions
B. subtilis ExpressionNative environment ensures proper folding; Post-translational modifications preservedLower protein yield compared to E. coliGrowth at 37°C; Induction at OD600 0.6-0.8
E. coli BL21(DE3)High protein yield; Well-established protocolsPotential protein misfolding; Inclusion body formationGrowth at 30°C; 0.5mM IPTG induction; Expression at 16°C overnight
Cell-free SystemsEliminates toxicity issues; Direct access to reaction environmentHigher cost; Lower yield30°C for 4-6 hours with membrane mimetics

When expressing membrane transporters like YwrA, using methodologies similar to those employed for the yclNOPQ operon proteins is recommended. This would involve amplifying the ywrA gene from B. subtilis genomic DNA, followed by cloning into appropriate vectors with fusion tags to facilitate detection and purification . For structural studies, engineering of constructs may be required, similar to approaches used for other membrane transporters.

How can I verify successful expression of recombinant YwrA protein?

Verification of YwrA expression can be performed through several complementary techniques:

  • Western blotting: Using anti-YwrA antibodies or antibodies against fusion tags. The protocol would be similar to that used for B. subtilis CotG-E-G and CotG-C-G verification, including collection of bacterial culture at logarithmic growth stage, cell lysis by sonication, protein separation by SDS-PAGE (10-12%), and immunodetection using appropriate antibodies .

  • Mass spectrometry: For precise identification of the protein and verification of its sequence integrity.

  • Fluorescence microscopy: If YwrA is tagged with fluorescent proteins to visualize its membrane localization.

  • Activity assays: While challenging for uncharacterized transporters, functional verification can be attempted through complementation studies in knockout strains.

What experimental approaches should I use to identify potential substrates of YwrA?

Identifying substrates for an uncharacterized transporter like YwrA requires a multi-faceted approach:

ApproachMethodologyExpected OutcomeLimitations
Knockout StudiesCreate ywrA deletion mutant; Compare growth patterns with wild-type under various conditionsIdentification of growth conditions where YwrA is essentialMay not reveal direct substrates if functional redundancy exists
Isotope-labeled Substrate TransportExpose bacterial cells to radiolabeled potential substrates; Compare uptake between wild-type and ΔywrADirect measurement of substrate transportRequires educated guesses about potential substrates
Metabolomic ProfilingLC-MS/MS analysis of metabolite differences between wild-type and ΔywrAIdentification of accumulated or depleted metabolitesComplex data interpretation; Indirect connection to transport
Binding AssaysSurface plasmon resonance or isothermal titration calorimetry with purified YwrADirect measurement of substrate binding affinitiesRequires purified protein in native conformation

Based on methodologies applied to other B. subtilis transporters, researchers could investigate whether YwrA is involved in siderophore transport, similar to the YclNOPQ system that transports petrobactin . This would involve testing the ability of ΔywrA mutants to utilize various iron-siderophore complexes and comparing their growth under iron-limited conditions to wild-type B. subtilis.

How can I determine the structure of YwrA and its functional mechanisms?

Structural determination of membrane transporters like YwrA presents significant challenges but is crucial for understanding functional mechanisms:

  • Computational prediction: Initial structure prediction can be performed using tools like I-TASSER, similar to the approach used for YclQ analysis . This involves threading the YwrA sequence against known structures, followed by refinement.

  • X-ray crystallography: Requires purification of stable, homogeneous protein, often with modifications to improve crystallization. The high-resolution structure of YclQ (1.75 Å) provides a precedent for successful crystallization of B. subtilis transporters .

  • Cryo-electron microscopy: Increasingly used for membrane proteins that are difficult to crystallize.

  • Site-directed mutagenesis: To identify functionally important residues, similar to studies conducted for YnfA transporters where conserved amino acid residues were targeted .

A comparative analysis with YclQ might reveal structural similarities if they belong to related transporter families. The conserved motifs identified in other transporters (as seen in YnfA) could guide the identification of functionally important regions in YwrA .

What is the role of YwrA in Bacillus subtilis stress response and antimicrobial resistance?

To investigate the potential role of YwrA in stress response and antimicrobial resistance:

  • MIC (Minimum Inhibitory Concentration) determination: Compare susceptibility of wild-type and ΔywrA strains to various antimicrobials using plate dilution methods, similar to approaches used for YnfA characterization .

  • Transport assays: Measure the efflux of fluorescent substrates (e.g., ethidium bromide or acriflavine) in wild-type versus ΔywrA strains to assess potential efflux activity .

  • Transcriptional analysis: Analyze ywrA expression under various stress conditions (oxidative stress, nutrient limitation, presence of antimicrobials) using RT-qPCR or RNA-seq.

  • Double knockout studies: Create strains with multiple transporter genes deleted to identify potential functional redundancy, similar to approaches used in characterizing the SMR family transporters .

How does YwrA expression change under different growth conditions?

Understanding the regulation of ywrA expression provides insights into its physiological role:

Growth ConditionExpected Expression PatternAnalytical MethodControl Genes
Iron limitationPotential upregulation if involved in iron acquisitionRT-qPCR, Western blotKnown iron-regulated genes (fur regulon)
Nutrient starvationPossible differential expression depending on substrateRNA-seq, ProteomicsGeneral stress response genes
Exponential vs. stationary phaseExpression pattern indicates growth phase-dependent functionTime-course sampling and expression analysisHousekeeping genes, phase-specific markers
Antimicrobial exposureUpregulation would suggest role in resistanceDose-dependent expression analysisKnown resistance genes

For reliable quantification, researchers should normalize ywrA expression against stable reference genes and compare results across multiple biological replicates. This approach mirrors the methodology used to study other transporters in B. subtilis, where expression is often regulated by specific environmental conditions, as seen with the siderophore-mediated iron acquisition systems that are activated under iron deprivation .

What are the most effective methods for creating and validating ywrA knockout mutants in B. subtilis?

Creating precise knockout mutants is essential for functional characterization:

  • Homologous recombination: Replace the ywrA gene with an antibiotic resistance marker by transforming B. subtilis with a construct containing homologous flanking regions.

  • CRISPR-Cas9 system: For precise genome editing without leaving marker genes, increasingly used in B. subtilis.

  • Validation protocols:

    • PCR verification: Using primers flanking the integration site

    • Sequencing: To confirm precise modification without unintended mutations

    • RT-PCR: To confirm absence of ywrA transcript

    • Western blot: To confirm absence of YwrA protein

    • Complementation: Reintroduction of ywrA should restore any phenotypes observed in the knockout

Similar approaches have been successfully employed for creating isogenic disruption mutants in the yclNOPQ transporter system, where complementation with copies of the respective genes restored the lost capabilities .

Can YwrA be utilized as a target for antimicrobial development against pathogenic Bacillus species?

While B. subtilis itself is non-pathogenic, understanding YwrA could have implications for related pathogenic species:

  • Ortholog identification: Sequence comparison analyses to identify YwrA orthologs in pathogenic Bacillus species (B. cereus group, B. anthracis), similar to how YclQ orthologs were identified in various Bacillus species .

  • Essential function assessment: Determine if YwrA and its orthologs are essential for pathogen survival or virulence, particularly under host-relevant conditions.

  • Inhibitor development strategy:

    • Structure-based drug design if crystal structure is available

    • High-throughput screening against purified protein

    • Whole-cell screening with sensitized strains overexpressing the transporter

The potential of targeting transporters for antimicrobial development has precedent in the literature, as noted for the petrobactin transporter: "Orthologs of the B. subtilis PB-transporter YclNOPQ in PB-producing Bacilli are likely contributors to the pathogenicity of these species and provide a potential target for antibacterial strategies" .

How can I determine the evolutionary relationships between YwrA and other bacterial transporters?

Understanding the evolutionary context of YwrA requires comprehensive phylogenetic analysis:

  • Sequence retrieval: Collect YwrA homologs from diverse bacterial species using BLASTP searches against protein databases.

  • Multiple sequence alignment: Using tools like Clustal-Omega to identify conserved motifs and domains, similar to the analysis performed for YnfA that revealed three conserved motif blocks essential for transporter function .

  • Phylogenetic tree construction: Using maximum likelihood or Bayesian inference methods.

  • Synteny analysis: Examine gene neighborhood conservation across species to identify functional associations.

  • Horizontal gene transfer assessment: Analyze GC content and codon usage bias to identify potential horizontal acquisition events.

This evolutionary analysis can provide insights into the functional specialization of YwrA and identify potential model organisms where its homologs have been better characterized, facilitating functional prediction.

What protein-protein interactions does YwrA engage in, and how do they affect its function?

Identifying interaction partners is crucial for understanding transporter function within cellular networks:

MethodApplication to YwrAExpected OutputChallenges
Bacterial two-hybridScreen for protein-protein interactions in vivoIdentification of direct interaction partnersPotential false positives/negatives
Co-immunoprecipitationPull-down of YwrA complexes from B. subtilisIdentification of stable interaction partnersRequires specific antibodies or tagged protein
Cross-linking mass spectrometryCapture transient interactionsDetailed interaction interfacesComplex data analysis
Fluorescence resonance energy transfer (FRET)Visualize interactions in living cellsSpatial and temporal dynamics of interactionsRequires fluorescent protein fusions

Particular attention should be paid to potential interactions with regulatory proteins, other components of transport systems (if YwrA functions as part of a complex similar to the YclNOPQ system ), and metabolic enzymes that might utilize transported substrates.

How does membrane composition affect YwrA function and substrate specificity?

As a membrane protein, YwrA's function is likely influenced by its lipid environment:

  • Lipidomic analysis: Compare membrane lipid composition between conditions where YwrA is active versus inactive.

  • Reconstitution studies: Purify YwrA and reconstitute in proteoliposomes with defined lipid compositions to assess activity variations.

  • Fluorescence anisotropy measurements: To determine how membrane fluidity affects YwrA mobility and function.

  • Site-directed spin labeling: To examine conformational changes in different membrane environments.

Understanding the lipid-protein interactions could provide insights into YwrA's mechanism and potentially explain any variations in activity observed under different growth conditions or in different bacterial strains.

What are the common challenges in expressing and purifying functional YwrA, and how can they be overcome?

Membrane protein expression and purification presents unique challenges:

ChallengePotential SolutionImplementation Details
Toxicity to expression hostUse tightly controlled inducible systemsOptimize inducer concentration and induction timing
Protein misfoldingExpress at lower temperatures (16-20°C)Slow expression rate allows proper folding
Low yieldUse specialized strains (C41/C43 for E. coli)These strains are adapted for membrane protein expression
Aggregation during purificationScreen different detergentsTest a panel including DDM, LMNG, and amphipols
Loss of functionNative purification from B. subtilisMaintain native environment throughout purification
Stability issuesAdd stabilizing ligands during purificationIf substrate candidates are identified, include them

For structural studies, stabilization of YwrA might be achieved through techniques such as thermostability engineering or generation of fusion constructs with stabilizing partners, approaches that have proven successful for other challenging membrane proteins.

How can I resolve conflicting experimental data about YwrA's function or structure?

Resolving contradictory results requires systematic investigation:

  • Standardize experimental conditions: Ensure consistent bacterial strains, growth media, and environmental conditions across experiments.

  • Validate reagents: Confirm antibody specificity, construct sequences, and strain genotypes.

  • Consider strain-specific effects: Different laboratory strains of B. subtilis might have variations affecting YwrA function.

  • Test alternative hypotheses: Design experiments that can directly distinguish between competing functional models.

  • Employ complementary techniques: If biochemical assays and genetic approaches yield different results, add structural or computational methods.

  • Reassess assumptions: Consider whether YwrA might have multiple functions or substrate specificities under different conditions.

When interpreting transport assay results, researchers should be particularly careful about potential indirect effects, as seen in studies of other transporters where disruption of one system can affect multiple cellular processes .

What new technologies or approaches could advance our understanding of YwrA beyond current limitations?

Emerging technologies offer new opportunities for characterizing challenging proteins like YwrA:

  • Cryo-electron tomography: For visualizing YwrA in its native membrane environment without isolation.

  • Single-molecule tracking: To observe the dynamics of individual YwrA molecules in living cells.

  • AlphaFold and other AI-based structure prediction: For generating high-confidence structural models even without experimental structures.

  • Nanobody development: For stabilizing specific conformations of YwrA for structural studies.

  • Microfluidics-based transport assays: For high-throughput screening of potential substrates.

  • CRISPR interference: For precise modulation of expression levels to study dosage effects.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data for a systems-level understanding of YwrA's role.

These advanced approaches could help overcome the limitations of traditional methods, particularly for an uncharacterized transporter where direct functional assays may be difficult to establish.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.