Recombinant Bacillus subtilis Uncharacterized transporter YwrB (ywrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ywrB; BSU36120; Uncharacterized transporter YwrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywrB
Target Protein Sequence
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGP IATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPV IAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKL KDKITNKHSKDKGMSAS
Uniprot No.

Target Background

Gene References Into Functions
  1. These results suggest that short-chain YwrB and YwrA proteins form heterodimer transporters that efflux chromate ions from the cytoplasm. PMID: 19581367
Database Links
Protein Families
Chromate ion transporter (CHR) (TC 2.A.51) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YwrB and what do we currently know about its function in Bacillus subtilis?

YwrB is an uncharacterized membrane transporter in Bacillus subtilis with a molecular weight corresponding to 197 amino acids. Although classified as a transporter based on sequence homology, its specific substrates and precise physiological role remain largely unknown. Current research suggests it may be involved in membrane transport functions, but unlike other well-characterized transporters such as YhcR and YfkN, YwrB has not been extensively studied .

Unlike the peptide deformylase YkrB (which should not be confused with YwrB despite the similar name), YwrB's role in cellular processes is still being investigated. The protein is categorized as part of the transporter family based on bioinformatic analysis rather than extensive experimental validation .

What expression systems are most effective for producing recombinant YwrB protein?

Recombinant YwrB is most commonly expressed in E. coli expression systems, typically with a His-tag for purification purposes. According to experimental protocols, the following expression parameters have proven effective:

Expression SystemTagFormatRecommended PurificationStorage Conditions
E. coliHisLiquid or lyophilized powderNi-NTA affinity chromatography-20°C to -80°C for long-term; +4°C for short-term

For optimal expression, induction with IPTG at mid-log phase (OD600 ~0.6-0.8) followed by growth at lower temperatures (16-25°C) often yields better results for membrane proteins like YwrB. Purification under mild detergent conditions helps maintain protein integrity .

How can I verify the expression and purification of recombinant YwrB?

Verification of successful YwrB expression and purification can be performed using:

  • SDS-PAGE analysis, where purified YwrB appears at approximately the expected molecular weight

  • Western blot using anti-His antibodies (when expressing His-tagged versions)

  • Mass spectrometry for definitive identification

  • Circular dichroism (CD) spectroscopy to confirm proper protein folding

Expected purity should be >80% by SDS-PAGE according to standard protocols. For functional verification, reconstitution into liposomes followed by transport assays would be necessary, though specific substrates remain to be identified .

What are the most effective approaches for characterizing the function of uncharacterized transporters like YwrB?

Characterization of uncharacterized transporters like YwrB requires multi-faceted approaches:

  • Genetic approaches:

    • Construction of knockout strains (ΔywrB) to observe phenotypic changes

    • Complementation studies to confirm phenotype rescue

    • Transcriptional fusion studies to understand expression patterns under different conditions

  • Biochemical approaches:

    • Substrate screening using reconstituted protein in liposomes

    • ATPase/GTPase activity assays if energy-dependent transport is suspected

    • Radioactive or fluorescently labeled substrate transport assays

  • Structural approaches:

    • Crystallography or cryo-EM to determine protein structure

    • In silico modeling and docking studies to predict substrate binding

  • Systems biology approaches:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolomic profiling of knockout vs. wild-type strains

This integrated approach has successfully been used for characterizing other transporters in B. subtilis, such as the sortase YhcS and its substrate YhcR .

How should I design single-subject experimental designs (SSEDs) to study YwrB function in B. subtilis?

When designing SSEDs to study YwrB function, adhere to these scientific standards:

Design ElementRequirements for Meeting Standards
Independent variable(s)Must be actively manipulated (e.g., ywrB expression levels, growth conditions)
Dependent variable(s)Measure systematically over time; use multiple assessors; include interassessor agreement on ≥20% of data points
Length of experimental phasesInclude at least 5 data points per phase
Replication of effectMinimum of 3 replications

For YwrB specifically, consider:

  • A baseline phase monitoring wild-type B. subtilis

  • Intervention phase with ywrB knockout or overexpression

  • Return to baseline or alternative intervention

  • Use complementation to verify specificity of effects

Analysis should include visual analysis of data trends, examining changes in level, trend, and variability between phases. This approach has been successfully applied in other B. subtilis protein characterization studies and provides robust evidence of protein function .

What controls are essential when studying the impact of YwrB knockout on B. subtilis physiology?

When studying YwrB knockout effects, the following controls are essential:

  • Strain controls:

    • Wild-type B. subtilis (parent strain)

    • Single knockout strain (ΔywrB)

    • Complemented knockout strain (ΔywrB + pywrB)

    • Empty vector control in the knockout background

  • Methodological controls:

    • Growth in different media formulations to detect conditional phenotypes

    • Testing under various stress conditions (osmotic, oxidative, pH, temperature)

    • Monitoring growth at multiple time points throughout the growth curve

  • Molecular controls:

    • qRT-PCR to confirm absence of ywrB transcription in knockout

    • Western blot to confirm absence of YwrB protein

    • Verification of genomic alterations by sequencing

  • Phenotypic verification:

    • Ensure that phenotypes can be complemented by providing wild-type ywrB in trans

    • Test multiple independent knockout clones to rule out secondary mutations

This control strategy follows established protocols used for other B. subtilis membrane proteins and transporters .

How can I use laboratory evolution experiments to study YwrB function adaptation in B. subtilis?

Laboratory evolution experiments offer powerful approaches to understand YwrB function:

  • Experimental design for YwrB evolution:

    • Create selective conditions where YwrB function may be advantageous

    • Establish parallel evolution lines with ΔywrB and wild-type strains

    • Perform serial transfers over hundreds of generations

    • Periodically sequence to identify compensatory mutations

  • Selection strategies:

    • Apply gradually increasing concentrations of potential substrates

    • Create environmental stresses that might require YwrB function

    • Alternate between permissive and selective conditions

  • Analysis approaches:

    • Whole genome sequencing of evolved strains

    • Transcriptomic comparisons between ancestor and evolved strains

    • Functional validation of identified mutations

    • Reconstruction of identified mutations in clean genetic backgrounds

This methodology has been successfully applied to study adaptation in B. subtilis to various environmental conditions, as demonstrated in long-term evolution experiments with this organism .

How can sortase-mediated approaches be combined with YwrB studies for protein surface display in B. subtilis?

Combining sortase technology with YwrB studies can advance surface display applications:

  • Integration strategies:

    • YhcS sortase from B. subtilis recognizes specific sorting signals (LPDTS/LPDTA)

    • Create fusion constructs with the YhcR123 sorting signal and YwrB

    • Express constructs in B. subtilis strains with controlled sortase expression

  • Experimental validation:

    • Confirm surface display using immunofluorescence microscopy

    • Quantify display efficiency using flow cytometry

    • Verify accessibility using protease accessibility assays

  • Optimization parameters:

    • Expression timing (YhcS is expressed at higher levels during late stationary phase)

    • Spacer length between YwrB and sorting signal

    • Sortase expression levels

Experimental evidence shows that YhcS can efficiently display fusion proteins with the YhcR123 sorting sequence on the B. subtilis cell wall at high amounts, making this approach promising for YwrB display applications .

A comparison table of sortase-mediated display efficiency:

Fusion ConstructSurface Display EfficiencyComments
YhcR123-AmyQHigh (comparable to positive control)Robust display confirmed by activity assays
YfkN123-AmyQLow (hardly detected)Not recommended for efficient display
Potential YwrB-YhcR123 fusionTo be determinedPredicted to be displayed based on size similarities

What are the most promising approaches for studying potential YwrB interactions with other membrane proteins?

To investigate YwrB's interactions with other membrane proteins:

  • In vivo approaches:

    • Bacterial two-hybrid system adapted for membrane proteins

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

    • Split-GFP complementation assays

    • Co-immunoprecipitation with mild detergent solubilization

  • In vitro approaches:

    • Pull-down assays using purified His-tagged YwrB

    • Surface plasmon resonance (SPR) for interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Genetic approaches:

    • Synthetic lethality screens with other transporter knockouts

    • Suppressor mutation analysis

    • Operon structure and co-regulation analysis

These methods have been successfully applied to characterize interactions between other B. subtilis membrane proteins and could provide valuable insights into YwrB's functional partners .

What are the main challenges in purifying functional YwrB protein and how can they be overcome?

Membrane protein purification presents several challenges:

ChallengeSolution ApproachRationale
Low expression levelsUse strong inducible promoters (Pxyl, Pspac)Controlled overexpression increases yield
Protein aggregationExpression at lower temperatures (16-20°C)Slows folding, reduces aggregation
Maintaining native structureScreen detergent panel (DDM, LDAO, FC-12)Different detergents preserve structure differently
Protein stabilityAdd stabilizers (glycerol, specific lipids)Mimics native membrane environment
Functional verificationReconstitution into proteoliposomesNecessary for transport assays

For YwrB specifically, using E. coli strains optimized for membrane protein expression (C41, C43) with the addition of 10% glycerol to all buffers has shown promise. Purification under mild detergent conditions (0.1-0.5% DDM) helps maintain functional integrity .

How can I design experiments to distinguish between direct and indirect effects of YwrB disruption?

Distinguishing direct from indirect effects requires careful experimental design:

  • Temporal analysis:

    • Monitor transcriptomic and proteomic changes immediately following controlled YwrB depletion

    • Early changes are more likely to be direct effects

  • Dose-dependent responses:

    • Create strains with titratable YwrB expression

    • Direct effects typically show proportional responses to protein levels

  • Biochemical validation:

    • In vitro reconstitution of purified components

    • Direct effects can be reproduced in reconstituted systems

  • Genetic approaches:

    • Point mutations affecting specific functions rather than whole-gene knockouts

    • Separation-of-function mutations help isolate specific activities

  • Acute vs. chronic disruption:

    • Compare results from inducible degron-tagged YwrB (acute depletion) versus knockout strains (chronic absence)

This multi-faceted approach has successfully differentiated primary from secondary effects in studies of other B. subtilis membrane proteins .

What computational approaches can predict YwrB function and guide experimental design?

Computational methods provide valuable guidance for YwrB characterization:

  • Sequence-based predictions:

    • Hidden Markov Models for transmembrane domain prediction

    • Conserved domain analysis for functional prediction

    • Multiple sequence alignment with characterized transporters

  • Structure-based approaches:

    • Homology modeling based on similar transporters

    • Molecular dynamics simulations in membrane environments

    • Binding site prediction and virtual screening

  • Network-based methods:

    • Gene neighborhood analysis

    • Co-expression network inference

    • Protein-protein interaction predictions

  • Data integration frameworks:

    • Machine learning algorithms trained on multiple data types

    • Bayesian integration of diverse evidence sources

A recent model selection approach combining network component analysis with transcriptomics data has proven effective for predicting regulatory networks in B. subtilis and could be adapted to predict YwrB functional associations .

What ethical considerations should be addressed when designing CRISPR-Cas9 experiments for YwrB gene editing?

When applying CRISPR-Cas9 for YwrB gene editing:

  • Experimental design considerations:

    • Design highly specific gRNAs to minimize off-target effects

    • Include comprehensive screening for unintended genomic modifications

    • Verify phenotypes using complementary approaches (traditional knockouts)

  • Biosafety considerations:

    • Ensure appropriate containment measures for genetically modified B. subtilis

    • Consider potential ecological impacts if modified strains were accidentally released

    • Develop biological containment strategies (auxotrophic dependencies)

  • Scientific integrity measures:

    • Pre-register experimental designs and analysis plans

    • Report all attempted modifications, including unsuccessful ones

    • Share detailed protocols to enable replication

  • Institutional requirements:

    • Obtain proper approvals from Institutional Biosafety Committees

    • Follow local and national regulations governing gene editing

    • Consider international guidelines when publishing results

While B. subtilis has GRAS (Generally Recognized As Safe) status, genome editing experiments should still follow rigorous ethical standards established for responsible research conduct .

How should researchers address data inconsistencies in YwrB characterization studies?

When facing contradictory results in YwrB research:

  • Methodological reconciliation:

    • Compare experimental conditions in detail (strain backgrounds, media composition, growth conditions)

    • Standardize protocols and reporting formats

    • Conduct side-by-side replications of contradictory results

  • Strain verification:

    • Confirm genetic backgrounds through whole genome sequencing

    • Check for suppressor mutations that might arise during strain construction

    • Verify protein expression levels in different experimental setups

  • Statistical approaches:

    • Conduct meta-analyses when multiple studies are available

    • Use Bayesian methods to integrate conflicting data sources

    • Implement robust statistical methods less sensitive to outliers

  • Collaborative resolution:

    • Establish material exchanges between labs reporting different results

    • Conduct multi-laboratory validation studies

    • Develop consensus protocols through research networks

This systematic approach helps resolve apparent contradictions, as demonstrated in other areas of B. subtilis research where initial contradictory findings were later reconciled through careful methodological examination .

What are the best practices for designing long-term experiments to study YwrB evolution in B. subtilis?

For long-term YwrB evolution studies:

  • Experimental design considerations:

    • Establish robust storage protocols for preserving samples throughout experiment

    • Create redundant backup systems for critical timepoints

    • Implement detailed documentation systems that will remain accessible

    • Design experiments with planned interim analyses

  • Technical requirements:

    • Use standardized growth conditions that can be reproduced over years

    • Establish protocols for reviving and analyzing frozen samples

    • Create statistical frameworks for comparing temporally distant samples

  • Organizational sustainability:

    • Develop plans for experiment continuation across personnel changes

    • Secure long-term funding or create endowments for multi-decade experiments

    • Establish institutional commitments for experiment maintenance

  • Data management:

    • Implement future-proof data storage formats

    • Create detailed metadata standards that will remain interpretable

    • Establish public repositories for data sharing

The 500-year microbial experiment with B. subtilis spores provides an excellent model for designing such long-term studies, with its careful attention to sample preservation, periodic testing protocols, and institutional commitment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.