Recombinant Bacillus subtilis UPF0014 membrane protein yjkA (yjkA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant yjkA

Recombinant Bacillus subtilis UPF0014 membrane protein yjkA (yjkA) is a bioengineered version of the native yjkA protein, produced via heterologous expression systems. Classified as a UPF0014 family membrane protein (UniProt ID: O34684), it is primarily associated with Bacillus subtilis strain 168, a model gram-positive bacterium. The recombinant form is widely used in structural, functional, and biotechnological studies due to its potential role in membrane processes, though its exact biological function remains uncharacterized .

Molecular Properties

ParameterDetails
Protein LengthFull-length (1–250 amino acids) or partial fragments
Molecular WeightNot explicitly reported (estimated ~28 kDa based on sequence)
Sequence FeaturesN-terminal His-tag in recombinant constructs; hydrophobic regions indicative of membrane integration
Expression SystemE. coli (common) or mammalian cells (less frequent)

The amino acid sequence of full-length yjkA includes hydrophobic stretches (e.g., residues 1–250), suggesting transmembrane domains . Recombinant versions are often modified with affinity tags (e.g., His-tag) to facilitate purification .

Functional Inferences

While yjkA’s direct role is unclear, its classification as a UPF0014 membrane protein implies involvement in:

  • Membrane transport: Potential association with ABC transporters or channel proteins .

  • Membrane biogenesis: Analogous to Bacillus subtilis proteins like SpoIIIJ and YqjG, which mediate membrane protein insertion .

  • Stress responses: Possible interaction with quality control systems, though not experimentally validated .

Expression and Isolation

Recombinant yjkA is produced using:

ParameterDetails
Host OrganismsE. coli (most common), mammalian cells, or cell-free systems
Purity>85–90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; shelf life: 12 months

Reconstitution and Handling

  • Reconstitution: Deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol .

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Functional Studies

While yjkA itself has not been directly studied, related Bacillus membrane proteins (e.g., SpoIIIJ, YqjG) demonstrate roles in:

  • Membrane protein insertion: Facilitating Sec-dependent and -independent pathways .

  • Respiratory complex assembly: Associating with F₁F₀-ATP synthase and cytochrome oxidase .

Comparative Analysis with Other Bacillus Membrane Proteins

ProteinKey FeaturesFunctional Role
yjkAUPF0014 family; recombinant His-tagHypothetical transport/biogenesis role
SpoIIIJOxa1p homolog; spore formationMembrane protein insertion (post-Sec)
YqjGOxa1p homolog; complement SpoIIIJATP synthase/F₀ subunit insertion
HtrAQuality control protease; stress responseProtease activity modulates secretion

Sources:

Challenges and Future Directions

  • Functional Elucidation: Experimental validation of yjkA’s role in membrane processes is lacking.

  • Structural Insights: Cryo-EM or X-ray crystallography could resolve its conformational dynamics.

  • Biotechnological Potential: Engineering yjkA variants for enhanced secretion in B. subtilis cell factories .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
yjkA; BSU12240; UPF0014 membrane protein YjkA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yjkA
Target Protein Sequence
MDYLSLSLTMIFVLIALFLSKSFKAGVEKDMIIATIRAAVQLLIIGYVLSLIFRGDHPVF ILLMVLLMLAVAAQNVIKRKKNTIGSFWRVFAALAIVEIVTQGILLSLHIIPLTARYVIP ISGMVIGNSMVLSSLFLNRLNSEVGVRKEEIQLILSLGGTPKQSIQRILTSAMKMSMIPT LESQKTLGLVQLPGMMTGQILAGADPIQAVRFQLLIVFTTMASAALTCVILSVLTYPSLF TVHQQLKQNE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0014 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.