Recombinant Bacillus subtilis UPF0053 protein yhdP (yhdP)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant yhdP is synthesized in E. coli using in vitro expression systems. Key production parameters include:

SupplierProduct CodePurityHostTag
MyBiosourceMBS7034495≥85% (SDS-PAGE)E. coliN/A
CusabioCSB-CF522478BRJ≥85% (SDS-PAGE)E. coliN-terminal His-tag
Aviva Systems BiologyOPCA53981≥85% (SDS-PAGE)E. coliN-terminal/C-terminal (variable)
Creative BioMartRFL32857BFN/AE. coliHis-tagged

Purification methods typically involve nickel affinity chromatography for His-tagged variants . Lyophilized or liquid formats are available, with glycerol (50%) or trehalose (6%) as stabilizers .

Magnesium Efflux Activity

yhdP is hypothesized to act as a magnesium efflux pump, regulated by extracellular Mg²⁺ concentrations. Studies indicate:

  • Induction: Upregulated 3-fold under high Mg²⁺ stress .

  • Genetic Interactions: Mutations suppress defects in 70S ribosome assembly, suggesting a role in cellular stress adaptation .

Pathway Involvement

While specific pathways remain unclear, yhdP’s CBS domains and transmembrane topology align it with:

  • Magnesium Homeostasis: Critical for enzyme function, membrane stability, and nucleotide synthesis.

  • Stress Response: Potential interaction with ribosomal proteins under Mg²⁺ limitation .

Applications in Research

Recombinant yhdP is utilized in:

  • Functional Studies: Investigating magnesium transport mechanisms.

  • Antibody Production: For immunological assays (ELISA, Western blotting).

  • Structural Analysis: Crystallization studies to resolve transmembrane domain architectures.

Suppliers like Aviva Systems Biology and Creative BioMart provide protocols for reconstitution, storage, and experimental workflows (e.g., WB/ELISA) .

Suppliers and Availability

SupplierProduct CodeFormatLead Time
MyBiosourceMBS7034495Liquid (glycerol)5–7 days
CusabioCSB-CF522478BRJLyophilizedN/A
Aviva Systems BiologyOPCA53981Lyophilized (Tris/PBS, trehalose)Custom
Genebio SystemsN/ALiquid (Tris/glycerol)50 µg standard

Prices vary by supplier and quantity, with bulk orders requiring direct inquiry .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yhdP; BSU09550; UPF0053 protein YhdP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhdP
Target Protein Sequence
MDIVNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLS ACQLGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGE LAPKTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHS EEELRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMD IIQIEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPI QDLLVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGH YILDGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGH HVAYIEVKKLQEEELLETANQQEA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0053 protein yhdP and what are its key characteristics?

The UPF0053 protein yhdP is a large inner membrane protein found in bacteria such as Bacillus subtilis and Escherichia coli. In B. subtilis, it is classified as a hypothetical protein with the systematic name BSU09550 . YhdP is characterized by:

  • A transmembrane structure with a large periplasmic domain

  • Size of approximately 1266 amino acids (139.1 kDa) in E. coli

  • Belongs to the AsmA-like protein family

  • Contains domains homologous to those found in lipid transporters

  • Anchored to the inner membrane (IM) with a structure that can span the periplasm

Structurally, the Bacillus subtilis YhdP protein contains distinct regions including an N-terminal transmembrane domain followed by several conserved regions that are predicted to form a hydrophobic interior that could accommodate lipids, similar to other membrane-associated transporters .

How is recombinant UPF0053 protein yhdP typically expressed and purified?

Recombinant UPF0053 protein yhdP can be expressed using several expression systems, with E. coli being the most common host for laboratory research. The methodology typically involves:

  • Expression systems:

    • E. coli expression systems offer the best yields and shorter turnaround times

    • Yeast expression systems also provide good yields

    • Insect cells with baculovirus or mammalian cells can provide posttranslational modifications necessary for correct protein folding or activity

  • Purification process:

    • The protein is commonly tagged for purification, with N-terminal 10xHis-tag being frequently used

    • Purification typically achieves >85% purity as verified by SDS-PAGE

  • Storage conditions:

    • Liquid form containing glycerol is recommended for storage

    • For extended storage, the protein should be conserved at -20°C or -80°C

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

  • Reconstitution:

    • For lyophilized forms, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended

    • Addition of 5-50% glycerol (final concentration) is advisable for long-term storage

What is the biological function of yhdP in bacterial systems?

Recent research has revealed crucial functions of yhdP in bacterial cell envelope biology:

  • Membrane homeostasis: YhdP plays a critical role in maintaining outer membrane (OM) integrity and proper glycerophospholipid (GPL) transport to the OM in Gram-negative bacteria .

  • Lipid transport: Evidence strongly suggests that YhdP and its homologs (TamB and YdbH) are involved in phospholipid transport from the inner membrane to the outer membrane . These proteins are proposed to be the long-sought-after phospholipid transporters required for OM biogenesis.

  • Antibiotic resistance: YhdP is critical for fitness in the presence of polymyxin and other antibiotics, with deletion of yhdP significantly reducing bacterial resistance. In E. coli, deletion of yhdP reduced the minimum inhibitory concentration (MIC) of polymyxin from 8 μg/mL to 0.38 μg/mL .

  • Redundant but essential function: YhdP, TamB, and YdbH are redundant but essential for bacterial envelope biogenesis, with the combined loss of all three being lethal, indicating they perform a critical function in the cell envelope .

What molecular mechanisms underlie the synthetic lethality observed when yhdP, tamB, and ydbH are simultaneously deleted?

The synthetic lethality observed with the triple deletion (ΔyhdP, ΔtamB, ΔydbH) reveals a sophisticated molecular mechanism:

  • Functional redundancy: YhdP, TamB, and YdbH are paralogous members of the AsmA-like clan that share structural features but differ in their efficiency at transporting phospholipids . Any single protein is sufficient for viability, indicating functional redundancy .

  • Lipid homeostasis disruption: The triple deletion disrupts the balance between LPS and glycerophospholipids in the outer membrane, leading to fatal membrane destabilization .

  • Compensatory mechanisms:

    • In single or double mutants, remaining proteins can partially compensate for the loss

    • Double mutants (ΔyhdP, ΔtamB) show increased OMV shedding, presumably to maintain outer membrane homeostasis by releasing excess LPS

    • Reduced LPS synthesis can rescue growth in these mutants by restoring proper LPS:GPL ratios

  • Cell morphology changes:

    • When GPL transport is partially restored through overexpression of YhdP, cells adjust their shape to accommodate increased membrane content

    • This morphological adaptation is a compensatory mechanism to deal with GPL accumulation in the inner membrane

Experimental data has shown that the ΔyhdP, ΔtamB double mutant exhibits:

  • Cell lysis in stationary phase

  • Severe vancomycin sensitivity

  • Excess OMV shedding

  • Altered cell morphology

These phenotypes can be rescued by reducing LPS synthesis, confirming that the lethality stems from an imbalance in membrane lipid composition rather than a complete loss of transport function.

How does yhdP's function differ between Gram-positive bacteria like B. subtilis and Gram-negative bacteria like E. coli?

The function of yhdP exhibits important distinctions between Gram-positive and Gram-negative bacteria due to their different cell envelope architectures:

  • In Gram-negative bacteria (E. coli):

    • YhdP is primarily involved in phospholipid transport from the inner membrane to the outer membrane

    • It works with TamB and YdbH to maintain outer membrane asymmetry and barrier function

    • Deletion leads to increased antibiotic sensitivity, particularly to polymyxin

    • It modulates the rate of PL transport in the anterograde direction

  • In Gram-positive bacteria (B. subtilis):

    • The specific function is less well-characterized due to the absence of an outer membrane

    • YhdP may be involved in maintaining cytoplasmic membrane integrity during stress conditions

    • It could play a role in membrane response to cell wall-targeting antibiotics like vancomycin

    • May function in conjunction with other membrane stress response systems like LiaRS (Lipid II cycle interfering antibiotic Regulator and Sensor) and CssRS two-component systems

The different cell envelope structures explain these functional divergences:

FeatureGram-negative (E. coli)Gram-positive (B. subtilis)
Cell envelopeInner membrane, periplasm, outer membraneCytoplasmic membrane, thick peptidoglycan layer
YhdP functionPhospholipid transport between membranesMembrane integrity maintenance during stress
Associated proteinsWorks with TamB and YdbHMay interact with LiaRS and CssRS systems
Response to stressIncreases OMV productionMay be involved in membrane depolarization response

Research approaches must be tailored to these differences, with Gram-negative studies focusing on inter-membrane transport and Gram-positive studies on membrane stress response mechanisms.

What are the key methodological considerations when analyzing the effects of yhdP mutations on bacterial phenotypes?

When analyzing phenotypic effects of yhdP mutations, researchers should consider these methodological aspects:

  • Growth condition optimization:

    • Test multiple growth conditions as phenotypes may only manifest under specific stresses

    • Include conditions that challenge membrane integrity (antibiotics, osmotic stress)

    • Compare exponential and stationary growth phases, as some phenotypes like cell lysis in ΔyhdP, ΔtamB mutants occur specifically in stationary phase

  • Control strain selection:

    • Include appropriate control strains (wild-type, single mutants) alongside double or triple mutants

    • When using complementation, include empty vector controls

    • Consider using conditional mutants for essential gene combinations

  • Quantitative phenotype measurements:

    • Minimum Inhibitory Concentration (MIC) determination for antibiotics using standardized methods like E-tests

    • Growth curve analysis under various conditions with appropriate biological and technical replicates

    • Cell morphology analysis using microscopy with quantitative parameters (cell length, width, etc.)

  • Membrane analysis techniques:

    • Membrane fractionation to separate inner and outer membranes

    • Lipid extraction and quantification to determine LPS:GPL ratios

    • Immunoblotting for LPS quantification

    • Fluorescence microscopy to assess membrane integrity

For instance, when analyzing antibiotic sensitivity in yhdP mutants, researchers have used:

  • Growth curves in liquid media with and without antibiotics (e.g., 4 μg/mL polymyxin)

  • E-tests to determine MIC values (wild-type WD101: 8 μg/mL; ΔyhdP: 0.38 μg/mL for polymyxin)

  • Plasmid complementation to verify phenotype rescue

These approaches provided clear quantitative data showing that loss of yhdP significantly reduces polymyxin resistance, which could be fully restored through complementation.

How can recombinant yhdP protein be applied in studies of bacterial membrane biogenesis?

Recombinant yhdP protein offers several research applications in membrane biogenesis studies:

  • In vitro transport assays:

    • Purified recombinant yhdP can be reconstituted into liposomes to study direct lipid transport activity

    • Fluorescently labeled lipids can be used as substrates to track transport kinetics

    • Compare wild-type and mutant versions to identify critical residues for function

  • Structural studies:

    • High-purity recombinant protein (>85% by SDS-PAGE) enables structural analyses

    • Cryo-electron microscopy can reveal the molecular architecture of yhdP and potential lipid-binding sites

    • Structural comparisons with eukaryotic lipid transporters like Vps13, which shares homology with TamB

  • Interaction studies:

    • Identify protein-protein interactions between yhdP and other membrane proteins

    • Investigate potential interactions with lipid substrates using binding assays

    • Study interactions with LPS and potential role in maintaining membrane asymmetry

  • Biochemical characterization:

    • Analyze lipid binding specificity using purified recombinant protein

    • Determine the energetics of transport through ATPase activity assays

    • Investigate the oligomeric state of functional yhdP complexes

Recombinant protein expression can be optimized using conditions described in the literature: E. coli expression systems for high yields, with purification via His-tag affinity chromatography, achieving >85% purity as verified by SDS-PAGE .

What approaches can researchers use to investigate the potential redundancy between yhdP and other AsmA-like proteins?

To investigate functional redundancy between yhdP and other AsmA-like proteins, researchers can employ these methodological approaches:

  • Systematic genetic analysis:

    • Create a comprehensive set of single, double, and triple deletion mutants of all AsmA-like proteins

    • Use controlled expression systems to precisely regulate protein levels

    • Implement CRISPR-Cas9 for accurate genome editing

  • Phenotypic screens:

    • Assess growth under various stress conditions (antibiotics, temperature, osmotic stress)

    • Measure membrane permeability using fluorescent dyes or antibiotic sensitivity

    • Quantify OMV production as an indicator of membrane stress

    • Examine cell morphology changes through microscopy

  • Cross-complementation assays:

    • Express each AsmA-like protein in various mutant backgrounds

    • Determine which proteins can rescue which phenotypes

    • Create chimeric proteins to identify functional domains

  • Quantitative lipidomics:

    • Compare membrane lipid composition in different mutant backgrounds

    • Track phospholipid transport rates between membranes

    • Analyze LPS:GPL ratios in the outer membrane

Research has already demonstrated important findings using these approaches:

GenotypeViabilityPhenotypeRescue Condition
ΔyhdPViableIncreased antibiotic sensitivityComplementation with yhdP
ΔtamBViableMild OM defectsN/A
ΔydbHViableNo obvious phenotypeN/A
ΔyhdP ΔtamBSynthetic lethality in some strains, severe defects in othersCell lysis in stationary phase, vancomycin sensitivityReduced LPS synthesis
ΔyhdP ΔtamB ΔydbHLethalN/AOverexpression of any of the three proteins

These findings show that YhdP, TamB, and YdbH perform redundant but essential functions in phospholipid transport, with any single protein being sufficient for viability .

How does the expression and function of yhdP change under different stress conditions?

Understanding yhdP's response to stress conditions provides insights into its physiological role:

  • Antibiotic stress responses:

    • YhdP becomes particularly critical during exposure to membrane-targeting antibiotics like polymyxin

    • In Tn-seq experiments, yhdP showed a fold change of -92 in polymyxin presence, indicating its critical role in antibiotic resistance

    • Gram-positive bacteria may show altered yhdP expression during exposure to cell wall-targeting antibiotics like vancomycin

  • Growth phase-dependent regulation:

    • Some phenotypes of yhdP mutations (such as cell lysis in yhdP, tamB double mutants) manifest specifically in stationary phase

    • This suggests growth phase-dependent changes in yhdP function or expression

    • Researchers should examine both exponential and stationary phase cultures when studying yhdP

  • Membrane stress conditions:

    • LPS synthesis alterations affect the importance of yhdP function

    • Reducing LPS levels can rescue growth defects in yhdP, tamB double mutants

    • This indicates that yhdP's function becomes more critical when membrane lipid homeostasis is disrupted

  • Experimental approaches to study stress responses:

    • Transcriptomics to monitor yhdP expression under different stress conditions

    • Proteomics to track changes in YhdP protein levels and potential post-translational modifications

    • Fluorescent protein fusions to monitor subcellular localization during stress

Research has shown that in E. coli WD101, deletion of yhdP had no effect on growth under normal conditions, but caused a severe growth defect in the presence of 4 μg/mL polymyxin . This indicates that while yhdP may be dispensable under optimal conditions, it becomes essential during antibiotic stress.

What are the latest findings regarding yhdP's role in lipid transport mechanisms?

Recent research has significantly advanced our understanding of yhdP's role in lipid transport:

A notable experimental finding shows that in mlaA* mutants (where anterograde PL transport causes the inner membrane to shrink and eventually rupture), deletion of yhdP reduced the rate of inner membrane transport to the outer membrane by 50%, slowing shrinkage of the inner membrane and delaying lysis . This directly demonstrates YhdP's role in facilitating phospholipid flow.

What are the optimal conditions for expression and purification of recombinant yhdP protein?

For researchers working with recombinant yhdP protein, these optimization strategies are recommended:

  • Expression system selection:

    • E. coli expression systems offer the best yields and shorter turnaround times for most research applications

    • Recommended strains include BL21(DE3) or Rosetta for efficient expression

    • For proper folding or activity, consider insect cells with baculovirus or mammalian cell expression systems

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding of large membrane proteins

    • Induction: Use lower IPTG concentrations (0.1-0.5 mM) for gentler induction

    • Media: Rich media like TB (Terrific Broth) may increase yield

    • Growth phase: Induce at mid-log phase (OD600 = 0.6-0.8) for optimal balance of growth and expression

  • Purification strategy:

    • Use N-terminal 10xHis-tag for efficient purification

    • Solubilization: Select appropriate detergents (DDM, LDAO) for membrane protein extraction

    • Include protease inhibitors throughout purification

    • Consider on-column refolding if inclusion bodies form

    • Aim for >85% purity as verified by SDS-PAGE

  • Buffer optimization:

    • Storage buffer should contain glycerol (typically 5-50%)

    • pH range: Maintain pH 7.0-8.0 for stability

    • Salt concentration: 150-300 mM NaCl typically maintains solubility

    • Consider adding reducing agents (DTT, β-mercaptoethanol) to prevent disulfide bond formation

  • Storage recommendations:

    • Store at -20°C or -80°C for extended storage

    • Keep working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • For reconstituted protein, maintain concentration between 0.1-1.0 mg/mL

Following these guidelines will help researchers obtain high-quality recombinant yhdP protein suitable for functional and structural studies.

How can researchers effectively design experiments to investigate yhdP's functional relationship with LPS transport and membrane integrity?

To investigate the relationship between yhdP, LPS transport, and membrane integrity, researchers should consider these experimental approaches:

  • Genetic manipulation strategies:

    • Create combinatorial mutations in yhdP and LPS transport/synthesis genes

    • Use the WD101 strain background which has been instrumental in revealing yhdP function

    • Implement inducible promoters to control expression levels of key proteins

  • Membrane integrity assays:

    • Antibiotic sensitivity testing using:

      • E-tests for MIC determination

      • Growth curves in the presence of various antibiotics (particularly polymyxin at 4 μg/mL)

      • Disc diffusion assays

    • Membrane permeability assays using:

      • Fluorescent dyes (DiSC3(5), SYTOX Green)

      • Propidium iodide for cell viability assessment

      • Outer membrane vesicle (OMV) quantification

  • LPS and lipid analysis:

    • Quantify LPS levels using immunoblotting

    • Measure LPS:GPL ratios in different membrane fractions

    • Track phospholipid movement between membranes

    • Analyze the rate of inner membrane shrinkage as an indicator of phospholipid flow

  • Microscopy techniques:

    • Phase contrast microscopy to monitor cell morphology

    • Fluorescence microscopy to track labeled lipids

    • Time-lapse microscopy to observe dynamic processes like membrane shrinkage

    • Single-cell analysis to capture heterogeneity in responses

Based on previous research, experiment design should incorporate:

  • Comparison of wild-type and ΔyhdP strains under antibiotic stress

  • Analysis of LPS levels in various genetic backgrounds

  • Rescue experiments through genetic manipulation of LPS synthesis

Previous research showed that lowering LPS levels rescued polymyxin resistance in WD101 ΔyhdP and viability of WD101 ΔyhdP, ΔtamB mutants . This suggests that decreasing LPS synthesis allows the cell to maintain OM asymmetry by matching the decrease in GPL transport to the OM.

How can researchers reconcile contradictory findings about yhdP function across different bacterial species and experimental conditions?

When facing contradictory findings about yhdP function, researchers should employ these methodological approaches to reconcile the differences:

  • Standardize experimental conditions:

    • Use consistent growth media, temperatures, and growth phases

    • Standardize strain backgrounds and ensure proper genetic validation

    • Implement identical stress conditions (antibiotic concentrations, exposure times)

    • Utilize the same quantification methodologies across studies

  • Address species-specific differences:

    • Recognize inherent differences between Gram-positive and Gram-negative bacteria

    • Account for differences in cell envelope architecture when comparing species

    • Consider evolutionary relationships between yhdP homologs across species

  • Integrate multiple experimental approaches:

    • Combine genetic, biochemical, and structural studies

    • Use both in vivo and in vitro approaches to validate findings

    • Implement systems biology approaches (transcriptomics, proteomics, lipidomics)

    • Supplement high-throughput screening with detailed mechanistic studies

  • Consider context-dependent functions:

    • YhdP may have different roles depending on growth conditions

    • Function may vary depending on the presence of other proteins (redundancy)

    • Phenotypes may only manifest under specific stress conditions

A framework for reconciling contradictory findings:

AspectE. coli FindingsB. subtilis FindingsReconciliation Strategy
Membrane functionPhospholipid transport Membrane integrity during stress Conduct comparative studies with standardized membrane assays
Antibiotic responseCritical for polymyxin resistance May be involved in vancomycin response Test multiple antibiotics across species with standardized methods
Essential natureSynthetic lethality with tamB and ydbH Less characterizedCreate equivalent mutants in both species
LPS interactionInfluences LPS:GPL ratios N/A (no LPS in Gram-positive)Focus on membrane homeostasis mechanisms common to both

By implementing these approaches, researchers can develop a more nuanced understanding of yhdP function that accounts for species-specific differences while identifying conserved mechanistic principles.

What cutting-edge techniques are most promising for elucidating the molecular mechanisms of yhdP-mediated lipid transport?

The most promising cutting-edge techniques for understanding yhdP's molecular mechanisms include:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy to resolve the structure of yhdP and its complexes

    • Single-particle analysis to capture different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and lipid-binding sites

    • X-ray crystallography for high-resolution structural details of soluble domains

  • Advanced lipid trafficking analysis:

    • Live-cell imaging with photoactivatable or photoconvertible lipid probes

    • Super-resolution microscopy (PALM, STORM) to visualize nanoscale lipid distribution

    • FRET-based biosensors to detect lipid transfer events in real-time

    • Microfluidics-based single-cell analysis for dynamic membrane studies

  • Biomolecular simulation approaches:

    • Molecular dynamics simulations to model lipid-protein interactions

    • Coarse-grained simulations to study large-scale membrane dynamics

    • Quantum mechanics/molecular mechanics (QM/MM) to investigate reaction mechanisms

    • Machine learning approaches to predict functional sites and interactions

  • Functional genomics and systems biology:

    • CRISPR-Cas9 screens to identify genetic interactions

    • Transposon-sequencing (Tn-seq) under various conditions to map fitness landscapes

    • Multi-omics integration (transcriptomics, proteomics, lipidomics) to build comprehensive models

    • Synthetic biology approaches to create minimal systems for mechanistic studies

  • Protein engineering and in vitro reconstitution:

    • Nanodiscs to study membrane proteins in defined lipid environments

    • Cell-free expression systems for rapid protein production and analysis

    • Site-specific incorporation of unnatural amino acids for mechanistic studies

    • In vitro reconstitution of transport activity in artificial membrane systems

For example, a comprehensive approach might combine:

  • Cryo-EM structure determination of yhdP

  • Lipidomic analysis of membrane composition in different mutant backgrounds

  • Live-cell imaging with fluorescent lipid probes to track transport in real-time

  • In vitro reconstitution of purified yhdP in liposomes to directly measure transport activity

This multi-faceted approach would provide both structural insights and functional validation of yhdP's role in lipid transport.

How might understanding yhdP function contribute to antibiotic development strategies?

Understanding yhdP function offers promising avenues for antibiotic development:

  • Direct targeting of lipid transport:

    • Since YhdP, TamB, and YdbH are essential for outer membrane biogenesis when all three are absent , inhibitors targeting these proteins could be effective antimicrobials

    • Small molecule inhibitors designed to block the hydrophobic transport channel could disrupt membrane integrity

    • Peptide-based inhibitors mimicking natural substrates could competitively inhibit transport

  • Sensitization strategies:

    • Research shows that yhdP deletion significantly increases antibiotic sensitivity (MIC reduction from 8 μg/mL to 0.38 μg/mL for polymyxin)

    • Developing adjuvants that inhibit yhdP function could potentiate existing antibiotics

    • This approach could revitalize the use of antibiotics facing resistance issues

  • Outer membrane destabilization:

    • Targeting the balance between LPS and phospholipids could compromise the outer membrane barrier

    • Combined inhibition of yhdP-mediated transport and LPS synthesis pathways could have synergistic effects

    • This dual-targeting approach could minimize resistance development

  • Species-selective targeting:

    • Differences in yhdP function between bacterial species could be exploited for selective targeting

    • This approach could lead to narrower-spectrum antibiotics with fewer effects on beneficial microbiota

  • Experimental approaches for antibiotic development:

    • High-throughput screens for yhdP inhibitors using bacterial reporter systems

    • Structure-based drug design utilizing resolved yhdP structures

    • Phenotypic screens for compounds that mimic yhdP deletion phenotypes

    • In vivo infection models to validate efficacy of targeting strategies

The critical role of yhdP in antibiotic resistance is evidenced by experimental data showing that loss of yhdP in E. coli reduced polymyxin resistance dramatically, with MIC values decreasing from 8 μg/mL to 0.38 μg/mL . This significant sensitization effect highlights the potential of targeting yhdP function in antibiotic development strategies.

What are the emerging roles of yhdP in bacterial adaptation to environmental stresses beyond antibiotic resistance?

YhdP's role extends beyond antibiotic resistance to broader environmental stress adaptation:

  • Membrane homeostasis during environmental fluctuations:

    • YhdP likely helps maintain membrane integrity during temperature changes, pH shifts, and osmotic stress

    • Its role in lipid transport may be critical for membrane remodeling in response to changing environments

    • This function is particularly important for soil bacteria like B. subtilis that face diverse environmental conditions

  • Stationary phase survival:

    • Research shows that yhdP, tamB double mutants exhibit cell lysis specifically in stationary phase

    • This suggests yhdP plays a role in maintaining membrane integrity during nutrient limitation

    • This function is critical for long-term survival in challenging environments

  • Stress response integration:

    • In B. subtilis, yhdP may interact with stress response systems like LiaRS (Lipid II cycle interfering antibiotic Regulator and Sensor) and CssRS

    • These systems respond to membrane and secretion stress, suggesting yhdP participates in coordinated stress responses

    • This integration allows for appropriate membrane adaptation to various stressors

  • Experimental approaches to study stress adaptation roles:

    • Long-term survival assays under various stress conditions

    • Transcriptomic and proteomic analysis of stress responses in wild-type vs. ΔyhdP strains

    • Competition experiments between wild-type and mutant strains under fluctuating conditions

    • Microscopic examination of membrane dynamics during stress adaptation

B. subtilis can grow in diverse environments because it withstands wide variations in temperature (11-52°C) and pH (6-9) . YhdP likely contributes to this remarkable adaptability by helping maintain membrane integrity during environmental fluctuations, especially through its potential interactions with stress response systems like LiaRS that are activated under membrane stress conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.