Recombinant Bacillus subtilis UPF0053 protein yhdT (yhdT)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis UPF0053 Protein yhdT

Recombinant Bacillus subtilis UPF0053 protein yhdT is a partial protein derived from the bacterium Bacillus subtilis, specifically from strain 168. This protein is part of the UPF0053 family and is produced using recombinant DNA technology, typically in a baculovirus system. The recombinant form allows for large-scale production and purification of the protein for research and potential biotechnological applications.

Characteristics of Recombinant Bacillus subtilis UPF0053 Protein yhdT

  • Purity: The protein is purified to a level of greater than 85% as determined by SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis) .

  • Source: The protein is produced in a baculovirus system, which is commonly used for expressing recombinant proteins in insect cells .

  • Target Name: The target name of this protein is yhdT, and it is also known as UPF0053 protein yhdT .

  • Uniprot Number: The Uniprot number for this protein is O07589 .

Data Table: Characteristics of Recombinant Bacillus subtilis UPF0053 Protein yhdT

CharacteristicsDescription
Purity>85% (SDS-PAGE)
SourceBaculovirus
Target NameyhdT
Uniprot NumberO07589
Shelf Life (Liquid)6 months at -20°C/-80°C
Shelf Life (Lyophilized)12 months at -20°C/-80°C

References Cusabio. Recombinant Bacillus subtilis UPF0053 protein yhdT (yhdT), partial. Scheidler et al. The multifunctionality of expression systems in Bacillus subtilis. PMC, 2021. Identification, Heterologous Expression, and Functional Characterization of Bacillus subtilis YutF, a HAD Superfamily 5'-Nucleotidase with Broad Substrate Specificity. PMC, 2016.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yhdT; BSU09590; UPF0053 protein YhdT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhdT
Target Protein Sequence
MDDIDSLILIGVLIALTAFFVASEFAIVRVRRSRIDQLITEGNKRAILARRVITDLDEYL SASQLGITLTSIGLGVLGEPAFERLLHPLFEPLGLPDSVSHAVSFAVAYGLITFLHVVVG ELAPKTVAIQKAEQLTLLIAGPLRLFYLLLFPFIWILNGSARLLCGMFGLKPASEHDGSH SEEELRMLLSESLKNGEINPSEYKYVNKIFEFDNRIAKEIMIPRKEMAAVSTEMTMAEML EVMLKEKYTRWPVTDGDKDSVLGLVNTKHLFSDLLFMTEEERMKMTIHPYVRPVIEVIET IPVHDLLIKMQRERIHMAILSDEYGGTSGLVTTEDILEEIVGEIRDEFDEDEQPLIQKLG DGHYVMDGKVRIDQVNSLLGASIQEDVDTIGGLILKENIDIEAGESIRIGSYTIKVLKMD GRLIKQIDIKEEAGNTTGITAHHKLPLPEPVMLNSATLSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0053 protein yhdT from Bacillus subtilis?

The yhdT protein is an uncharacterized protein belonging to the UPF0053 protein family in Bacillus subtilis. It is encoded by the yhdT gene in B. subtilis strain 168. The protein is relatively small, consisting of 80 amino acids in its full-length form . As an uncharacterized protein, its precise biological function remains to be fully elucidated, making it an interesting target for fundamental research into bacterial protein function and interactions .

What are the basic biochemical properties of the yhdT protein?

The yhdT protein has the following biochemical characteristics:

PropertyValue
UniProt IDO07589
Amino acid sequenceMDTRFVQAHKEARWALGLTLLYLAVWLVAAYLSGVAPGFTGFPRWFEMACILTPLLFIGLCWAMVKFIYRDIPLEDDDAA
Length80 amino acids (full length)
Molecular weight~9 kDa (approximate)
Protein familyUPF0053
OrganismBacillus subtilis (strain 168)

How can I express recombinant yhdT protein in a laboratory setting?

The recombinant expression of yhdT can be achieved using several systems, with E. coli being the most commonly employed host. Based on current methodologies:

  • Vector selection: pET-based expression vectors are commonly used for recombinant protein expression. For yhdT specifically, systems that allow for tag addition (such as His-tag) facilitate subsequent purification .

  • Host strain: E. coli strains optimized for protein expression such as BL21(DE3) are suitable for yhdT expression .

  • Expression protocol:

    • Transform the expression vector containing the yhdT gene into the host strain

    • Grow transformed cells in appropriate media (typically LB with appropriate antibiotics)

    • Induce protein expression (commonly with IPTG if using a T7-based system)

    • Harvest cells and extract protein using suitable lysis methods

  • Alternative expression in B. subtilis: If native-like conditions are desired, B. subtilis WB800N strain can be used as shown in other recombinant protein studies. This strain has reduced protease activity, making it suitable for heterologous protein expression .

What purification strategies yield the highest purity of recombinant yhdT?

For optimal purification of recombinant yhdT protein:

  • Affinity chromatography: If expressed with a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is highly effective. The protocol should include:

    • Cell lysis in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10 mM imidazole

    • Binding to Ni-NTA resin

    • Washing with increasing imidazole concentrations (20-50 mM)

    • Elution with high imidazole (250-500 mM)

  • Secondary purification: For higher purity, follow with size exclusion chromatography (SEC) using a suitable column (Superdex 75 or similar) in a physiological buffer .

  • Quality assessment: Purity should be analyzed using SDS-PAGE (>85% purity is typically achievable with this approach) .

  • Storage considerations: The purified protein can be stored with 50% glycerol at -20°C/-80°C to maintain stability. For lyophilized preparations, reconstitution in deionized sterile water to 0.1-1.0 mg/mL is recommended .

How can I verify the structural integrity of purified yhdT protein?

To confirm the structural integrity of purified yhdT:

  • Western blotting: Using antibodies against the tag or, if available, against the protein itself

  • Mass spectrometry:

    • MALDI-TOF or ESI-MS to confirm molecular weight

    • Peptide mass fingerprinting after tryptic digestion for sequence verification

  • Circular dichroism (CD) spectroscopy: To assess secondary structure elements and proper folding

  • Dynamic light scattering (DLS): To check for aggregation and determine the hydrodynamic radius

  • Limited proteolysis: To evaluate domain organization and stability

What are the methodological approaches for studying yhdT protein-protein interactions?

Several techniques can be employed to study yhdT interactions with other proteins:

  • Yeast Two-Hybrid (Y2H) screening:

    • Clone yhdT as bait (BD fusion) and screen against a B. subtilis cDNA library

    • Use a matrix-based approach for known candidate interactions

    • Validate positive interactions using in vitro methods

  • Tandem Affinity Purification coupled with Mass Spectrometry (TAP-MS):

    • Generate a TAP-tagged yhdT construct

    • Express in B. subtilis for native interactions or in a heterologous system

    • Purify protein complexes using the dual affinity tags

    • Identify interaction partners by mass spectrometry

  • Proximity-based labeling:

    • Recent methods developed at the University of Chicago enable detection of proteins in close proximity within individual cells

    • This approach provides information about functional protein groupings rather than just abundance

  • Cross-linking studies:

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Photo-crosslinking using genetic code expansion in B. subtilis with non-standard amino acids

How can genetic code expansion techniques be applied to study yhdT function?

Genetic code expansion provides powerful tools for studying yhdT:

  • Incorporation of non-standard amino acids (nsAAs):

    • B. subtilis genetic code expansion systems can incorporate up to 20 distinct nsAAs

    • Three different families of genetic code expansion systems and two codon choices are available

    • These systems enable click-labeling, photo-crosslinking, and translational titration

  • Methodological approach:

    • Select appropriate orthogonal tRNA/aminoacyl-tRNA synthetase pairs

    • Design constructs with amber (UAG) codons at sites of interest

    • Express in B. subtilis in media supplemented with the desired nsAA

    • Applications include site-specific fluorescent labeling, crosslinking for interaction studies, and photo-control of protein function

  • Example protocol for photo-crosslinking:

    • Incorporate photo-reactive nsAAs (e.g., p-benzoyl-L-phenylalanine) at predicted interaction sites

    • UV-irradiate to activate crosslinking

    • Analyze crosslinked products by Western blotting and mass spectrometry

How can I optimize expression of recombinant yhdT in Bacillus subtilis?

To optimize yhdT expression in B. subtilis:

  • Promoter selection:

    • For constitutive expression: P43 or Pveg promoters

    • For inducible expression: IPTG-inducible Pgrac212 system or xylose-inducible PxylA system

    • For self-inducing systems: Psrfa-based systems that respond to quorum sensing

  • Strain selection:

    • B. subtilis WB800N has eight deleted protease genes, improving protein yield

    • For secreted expression, consider strains with enhanced secretion capacity

  • Codon optimization:

    • Adapt the coding sequence to B. subtilis codon usage bias

    • Remove rare codons and optimize GC content

  • Expression enhancement strategies:

    • Co-expression with chaperones to improve folding

    • Optimization of culture conditions (temperature, media composition)

    • Signal peptide selection for secreted expression

Promoter SystemInducerExpression LevelAdvantages
Pgrac212IPTGHigh (up to 16% of total cellular protein)Tight regulation, high yield
PxylAXyloseModerate to highLower cost than IPTG
PsrfaSelf-inducing (quorum sensing)ModerateNo need for external inducers
P43ConstitutiveModerateSimple cultivation, no inducer needed

What approaches can be used to determine the functional role of yhdT protein?

To investigate the function of this uncharacterized protein:

  • Gene knockout and phenotypic analysis:

    • Generate a yhdT deletion strain in B. subtilis

    • Compare growth under various conditions (different temperatures, pH, osmotic stress)

    • Examine cell morphology, division, and stress responses

  • Transcriptomic and proteomic analysis:

    • RNA-Seq of wild-type vs. ΔyhdT strains

    • Proteome analysis using methods similar to those in the UK Biobank proteomic study

    • Metabolomic profiling to identify affected pathways

  • Genome-scale metabolic modeling:

    • Utilize systems biology approaches such as the B. subtilis ME-model (iJT964-ME)

    • Predict potential metabolic roles and stress responses

    • Validate predictions experimentally

  • Localization studies:

    • GFP fusion proteins to determine subcellular localization

    • Membrane fractionation to confirm membrane association

    • Immunogold electron microscopy for high-resolution localization

How does yhdT expression respond to different stress conditions in B. subtilis?

Understanding stress responses requires:

  • Quantitative expression analysis:

    • RT-qPCR to measure transcript levels under different stresses

    • Western blotting with specific antibodies to monitor protein levels

    • Reporter gene fusions (e.g., yhdT promoter-GFP) for real-time monitoring

  • Stress conditions to test:

    • Ethanol stress (relevant to B. subtilis stress response mechanisms)

    • Salt stress

    • Oxidative stress (H₂O₂ or paraquat)

    • Nutrient limitation

    • Heat shock

  • Integration with omics data:

    • Compare with datasets from the ME-model validation studies

    • Correlate yhdT expression changes with global stress response patterns

What protein quantification methods are most accurate for determining yhdT concentration?

For accurate quantification of yhdT protein:

  • Direct methods:

    • Amino acid analysis (AAA): The gold standard method that determines actual protein content by measuring individual amino acids after hydrolysis

    • Spectrophotometric methods using calculated extinction coefficients

  • Indirect methods and their limitations:

    • Bradford assay: Prone to interference from detergents and buffer components

    • Lowry method: More sensitive than Bradford but influenced by non-protein substances

    • BCA assay: Compatible with many detergents but affected by reducing agents

  • Comparison of methods:

MethodAdvantagesLimitationsAccuracy
Amino acid analysisMost accurate, directly measures protein contentTime-consuming, requires specialized equipmentHighest
Kjeldahl methodTraditional reference methodMeasures total nitrogen, not specific to proteinModerate, uses conversion factors
Bradford assayQuick, simple procedureInterference from detergents, limited linear rangeLow to moderate
BCA assayCompatible with many detergentsAffected by reducing agentsModerate
A280 measurementQuick, non-destructiveRequires pure protein preparationGood for pure samples

Amino acid analysis is recommended as the most accurate method for yhdT quantification in research settings .

How can I design experiments to validate predicted protein-protein binding interfaces involving yhdT?

To validate predicted interaction interfaces:

  • Computational prediction of interfaces:

    • Use protein-protein docking software

    • Predict critical residues at the interface

    • Generate testable hypotheses about interaction mechanisms

  • Mutational analysis:

    • Create alanine scanning mutations at predicted interface residues

    • Express and purify mutant proteins

    • Measure binding affinities using biophysical methods

  • Photo-crosslinking validation:

    • Incorporate photo-reactive amino acids at predicted interface sites using genetic code expansion in B. subtilis

    • Perform crosslinking experiments to capture interactions

    • Identify crosslinked peptides by mass spectrometry

  • Biophysical validation methods:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamics of binding

    • NMR chemical shift perturbation to map interaction surfaces

This approach has proven successful in validating predicted protein-protein binding interfaces in B. subtilis, as demonstrated in recent genetic code expansion studies .

How can metabolic modeling approaches improve our understanding of yhdT function?

Metabolic modeling provides valuable insights into yhdT function:

What emerging technologies show promise for studying uncharacterized proteins like yhdT?

Several cutting-edge approaches are particularly valuable for studying proteins with unknown functions:

  • AI-driven protein design and analysis:

    • New AI frameworks incorporate experimental data and text-based narratives to accelerate protein research

    • These approaches can generate testable hypotheses about protein function based on structural features

    • A combination of simulation data and experimental validation can optimize protein design and function prediction

  • High-throughput protein interaction mapping:

    • Recent advances in protein proximity labeling enable mapping of protein interaction networks at unprecedented scale

    • These methods provide insights into functional relationships and can suggest roles for uncharacterized proteins

  • Single-cell proteomics:

    • New methods for studying proteins at the single-cell level can reveal cell-to-cell variability in protein abundance and localization

    • This approach is particularly valuable for understanding heterogeneous responses to stress conditions

  • CRISPR-based functional genomics:

    • Systematic gene editing and screening approaches can reveal genetic interactions

    • CRISPRi/CRISPRa systems allow controlled modulation of gene expression without permanent genetic changes

    • These approaches can help position yhdT within cellular pathways

What is the recommended experimental workflow for characterizing yhdT function?

Based on current methodologies, we recommend the following research workflow:

  • Initial characterization:

    • Expression and purification of recombinant yhdT protein

    • Structural analysis (secondary structure prediction, disorder analysis)

    • Subcellular localization studies

  • Functional analysis:

    • Gene knockout and phenotypic characterization

    • Global approaches (transcriptomics, proteomics) to identify affected pathways

    • Protein-protein interaction studies using multiple complementary techniques

  • Mechanistic studies:

    • Site-directed mutagenesis of conserved residues

    • Genetic code expansion for photo-crosslinking

    • Detailed biochemical characterization of any identified activities

  • Integration with systems biology:

    • Incorporation of findings into metabolic models

    • Generation and testing of new hypotheses from model predictions

    • Iterative refinement of functional understanding

This comprehensive workflow leverages cutting-edge techniques while maintaining rigorous validation at each step to ensure reliable characterization of this uncharacterized protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.