Recombinant Bacillus subtilis UPF0053 protein yqhB (yqhB)

Shipped with Ice Packs
In Stock

Description

General Information

The compound "Recombinant Bacillus subtilis UPF0053 protein yqhB" refers to a protein derived from the bacterium Bacillus subtilis . Specifically, it is a recombinant form of the protein, meaning it is produced using genetic engineering techniques, often in a host organism different from the original source, to generate large quantities of the protein for research or industrial purposes. The "UPF0053" designation indicates that this protein belongs to a protein family of unknown function (UPF: Unknown Protein Family), and "yqhB" is the gene name that encodes this protein in Bacillus subtilis .

Properties and Characteristics

  • Stress Response: Many proteins in Bacillus subtilis, including those initially classified as unknown, are involved in the general stress response, contributing to the bacterium's ability to withstand environmental challenges .

  • DNA Repair: Some Bacillus subtilis proteins participate in DNA repair mechanisms, protecting the cell's genetic material from damage during dormancy and germination . For example, YqfS is a spore-specific protein that helps repair AP sites and 3' blocking groups in DNA .

  • 5'-Nucleotidases: Bacillus subtilis contains 5'-nucleotidases like YutF, which are involved in the regulation of nucleotide pools and exhibit phosphohydrolase activity .

  • Structural Insights: Structural studies of hypothetical proteins, such as YqgQ, have revealed novel protein folds and potential functions like single-stranded nucleic acid binding .

Table 1: General Properties of Recombinant Bacillus subtilis Proteins

PropertyDescription
Source OrganismBacillus subtilis (strain 168)
Expression SourceOften Escherichia coli or Baculovirus for recombinant production
Molecular WeightVaries depending on the specific protein; YqgQ is 8.6 kDa
Purity>85% (SDS-PAGE) for some recombinant proteins
Storage ConditionsLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage
Potential FunctionsStress management, DNA repair, nucleotide regulation, single-stranded nucleic acid binding

Potential Applications

  • Biotechnology: As a recombinant protein, yqhB could be utilized in various biotechnological applications, pending further functional characterization.

  • Drug Discovery: Understanding the function of yqhB may reveal novel targets for developing antimicrobial agents or drugs that modulate stress response pathways in bacteria.

  • Industrial Applications: Bacillus subtilis is used in the industry for the production of enzymes, and understanding the roles of proteins like yqhB can help optimize strains for specific applications.

Table 2: Potential Applications Based on Related Research

Protein/FunctionPotential Applications
YqfS (DNA Repair)Development of protective agents against DNA damage; enhancing spore viability.
YutF (5'-Nucleotidase)Modulation of nucleotide metabolism; potential use in nucleotide synthesis or degradation pathways.
Stress Response ProteinsImproving bacterial resistance to environmental stressors in industrial processes; developing stress-resistant strains.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhB; BSU24750; UPF0053 protein YqhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqhB
Target Protein Sequence
MPSLEKAVVLEFINLLAVAILILLTGFFVAVEFSIVKVRRSKIDQLVAKGKKGAKAAKHV ITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAGLNESLTHLLSLVIAFLVV TYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFIWLLNHSARLITGVFGLKP ASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDKRMAKEIMVPRNEMVSLSL DEDSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLFSMLTKDFSIKKHQIEPFVQ PVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVTVEDIIEEIVGEIRDEFDADE VPHIRELGKDHYLLNAKLLISDVNSLLGTDLSEAEVDTLGGWFLTQNIDAEPESAIEYDG YSFKVKDINSHHILFIEVKKAE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0053 protein yqhB in Bacillus subtilis and what is its significance?

The UPF0053 protein yqhB (yqhB) is a transmembrane protein encoded by the yqhB gene in Bacillus subtilis strain 168. It belongs to the UPF0053 protein family, a group of uncharacterized proteins with conserved function. The full-length protein consists of 442 amino acids and has a distinctive membrane-spanning structure .

The protein's significance stems from its potential role in membrane transport processes, though its exact function remains under investigation. Its conservation across different Bacillus species suggests it may play an important role in fundamental cellular processes. Research into yqhB contributes to our understanding of bacterial membrane biology and potentially to applications in biotechnology using B. subtilis as an expression system .

What expression systems are used to produce Recombinant Bacillus subtilis UPF0053 protein yqhB?

The production of Recombinant Bacillus subtilis UPF0053 protein yqhB typically employs two main expression systems:

  • E. coli expression systems: The most commonly used approach involves heterologous expression in E. coli, as evidenced by commercial preparations that utilize "in vitro E.coli expression systems" . This approach typically incorporates N-terminal tags (such as the 10xHis-tag) to facilitate purification.

  • Bacillus subtilis expression systems: Given B. subtilis' natural capacity for protein secretion, homologous expression systems have been developed. These systems leverage B. subtilis' three distinct protein secretion pathways and abundant molecular chaperones .

The choice between these systems depends on research objectives. E. coli systems often yield higher initial protein quantities, while B. subtilis systems may provide better folding for certain applications and simplified downstream processing due to secretion capabilities .

What are the structural characteristics of the UPF0053 protein yqhB?

The UPF0053 protein yqhB from Bacillus subtilis exhibits several important structural characteristics:

  • Amino acid composition: The full 442-amino acid sequence contains distinctive hydrophobic regions consistent with its transmembrane nature. The complete sequence is: MPSLEKAVVLEFINLLAVAILILLTGFFVAVEFSIVKVRRSKIDQLVAKGKKGAKAAKHVITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAGLNESLTHLLSLVIAFLVVTYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFIWLLNHSARLITGVFGLKPASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDKRMAKEIMVPRNEMVSLSLDEDSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLFSMLTKDFSIKKHQIEPFVQPVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVTVEDIIEEIVGEIRDEFDADEVPHIRELGKDHYLLNAKLLISDVNSLLGTDLSEAEVDTLGGWFLTQNIDAEPESAIEYDGYSFKVKDINSHHILFIEVKKAE

  • Transmembrane domains: Computational analysis predicts multiple membrane-spanning regions, consistent with its classification as a transmembrane protein.

  • Functional domains: While the exact function remains uncharacterized (hence the UPF designation - Uncharacterized Protein Family), sequence analysis suggests potential involvement in membrane transport processes.

  • Tagged recombinant versions: In laboratory contexts, the protein is typically expressed with an N-terminal 10xHis-tag to facilitate purification and detection .

How does the WalRK two-component system interact with or regulate proteins like yqhB in Bacillus subtilis?

The WalRK two-component system (TCS) represents one of the most conserved regulatory systems in Firmicutes, including Bacillus subtilis. While direct regulation of yqhB by WalRK has not been explicitly documented in the provided sources, understanding this potential interaction requires consideration of several factors:

The WalRK system consists of:

  • WalK: A membrane-anchored sensor kinase (also called YycG/VicK/MicA)

  • WalR: A DNA-binding response regulator (also called YycF/VicR/MicB)

  • Associated regulatory proteins WalH and WalI (YycH and YycI)

This system primarily regulates cell wall metabolism and homeostasis. The WalR regulon in B. subtilis and related bacteria contains genes encoding cell wall hydrolases . As a transmembrane protein, yqhB may potentially fall under this regulatory network, either directly or indirectly.

Researchers investigating potential interactions between yqhB and the WalRK system should consider:

  • Transcriptional analysis: Examining yqhB expression under conditions of WalRK upregulation or downregulation

  • DNA-binding studies: Investigating whether WalR binds to promoter regions of yqhB

  • Bacterial two-hybrid assays: The Bacterial Adenylate Cyclase-based Two Hybrid (BACTH) system described in source would be an appropriate methodology to test for potential protein-protein interactions

The essential nature of WalRK in most Firmicutes makes it challenging to study through simple knockout approaches, necessitating conditional expression systems or partial depletion methods .

What optimization strategies can enhance the expression and secretion of recombinant UPF0053 protein yqhB in Bacillus subtilis?

Optimizing the expression and secretion of recombinant UPF0053 protein yqhB in Bacillus subtilis involves several strategic approaches that address the common limitations of this expression system:

Table 1: Key Optimization Strategies for Recombinant Protein Expression in B. subtilis

Optimization TargetStrategyExpected Impact
Promoter SelectionUse of strong inducible promoters appropriate for membrane proteinsControlled expression levels preventing toxicity
Expression VectorIntegration of stability elements and optimal regulatory sequencesReduced gene loss and increased expression stability
Signal PeptideSelection/engineering of signal peptides specific for transmembrane proteinsEnhanced targeting to appropriate secretion pathway
Transport PathwaysOptimization of Sec or Tat secretion machinery componentsImproved translocation efficiency
Molecular ChaperonesCo-expression of specific chaperones that assist membrane protein foldingReduced aggregation and improved functional yield
Genome MinimizationRemoval of counterproductive traits (proteases, prophages, sporulation genes)Reduction in proteolytic degradation and metabolic burden

Recent studies have shown that genome-minimized B. subtilis strains can achieve over 3000-fold increased secretion of certain proteins compared to parental strains . For membrane proteins like yqhB, specific considerations include:

  • Controlled expression: Overly strong promoters can lead to membrane protein aggregation; therefore, titratable or moderately strong promoters are often preferable

  • Lipid environment optimization: Supplementing growth media with specific lipids may enhance proper folding

  • Temperature modulation: Lower growth temperatures (25-30°C) often improve membrane protein yields

A comprehensive optimization approach should combine these strategies based on experimental findings for the specific protein .

What analytical methods are most appropriate for characterizing the structure and function of UPF0053 protein yqhB?

Characterizing the structure and function of UPF0053 protein yqhB requires a multi-faceted analytical approach due to its transmembrane nature and uncharacterized function:

Structural Characterization:

  • Membrane Protein Crystallography: Though challenging, this represents the gold standard for high-resolution structural determination. Approaches including lipidic cubic phase crystallization may be suitable.

  • Cryo-Electron Microscopy: Increasingly powerful for membrane protein structure determination, particularly when incorporated into nanodiscs or other membrane mimetics.

  • Circular Dichroism (CD) Spectroscopy: Provides secondary structure information (α-helical content vs. β-sheets) that is particularly valuable for transmembrane domains.

  • NMR Spectroscopy: Solution NMR with detergent-solubilized protein or solid-state NMR can provide dynamic structural information.

Functional Characterization:

  • Protein-Protein Interaction Studies: The Bacterial Adenylate Cyclase-based Two Hybrid (BACTH) system is particularly valuable for identifying interaction partners . The methodology involves:

    • Fusion of yqhB to complementary fragments (T18 and T25) of Bordetella pertussis adenylate cyclase

    • Co-transformation into E. coli BTH101 cells

    • Selection on appropriate media (LB with ampicillin, kanamycin, IPTG, and X-Gal)

    • Analysis of colony color to detect protein interactions

  • Transport Assays: If yqhB functions as a transporter, radioactive or fluorescently labeled substrate transport assays would be appropriate.

  • Phenotypic Analysis of Gene Knockouts: Creating yqhB deletion mutants and assessing phenotypic changes under various stress conditions.

  • Genetic Suppressor Screens: Identifying mutations that compensate for yqhB deletion can reveal functional pathways.

For transmembrane proteins like yqhB, the challenge of maintaining native structure during purification necessitates careful detergent selection or the use of membrane mimetics such as nanodiscs or amphipols .

What expression vector design considerations are critical for successful production of UPF0053 protein yqhB?

Designing effective expression vectors for UPF0053 protein yqhB production requires careful consideration of multiple elements to overcome the challenges associated with membrane protein expression:

Table 2: Critical Expression Vector Elements for yqhB Production

Vector ElementOptimal DesignRationale
PromoterTitratable/moderate strength (e.g., Pspac or PxylA)Prevents toxic overexpression common with membrane proteins
Ribosome Binding SiteOptimized spacing and complementarityEnsures efficient translation initiation
Fusion TagsN-terminal 10xHis-tag with protease cleavage siteFacilitates purification while allowing tag removal
Codon UsageCodon optimization for expression hostEnhances translation efficiency
Origin of ReplicationLow-medium copy number for membrane proteinsPrevents overwhelming cell membrane capacity
TerminatorsStrong intrinsic terminatorsPrevents transcriptional read-through
Signal SequenceIf secretion is desired, Sec-dependent signal peptideDirects protein to appropriate secretion pathway

For optimized expression in B. subtilis specifically, vectors should address the issue of genetic instability, as B. subtilis is prone to "easy gene loss" during recombinant protein production . Strategies include:

  • Chromosomal integration: Rather than maintaining plasmids, integrating the expression cassette into the chromosome at neutral sites (e.g., amyE or lacA loci) enhances stability.

  • Selective marker optimization: Using food-grade selection systems rather than antibiotic resistance markers for long-term stability.

  • Genetic stabilization elements: Incorporating elements that prevent genetic rearrangements.

The choice between E. coli and B. subtilis expression systems should be guided by experimental objectives. If purifying the protein for structural studies, E. coli systems with suitable membrane protein tags (e.g., fusion to maltose-binding protein) may be preferable. For functional studies or when secretion is advantageous, optimized B. subtilis strains may be more appropriate .

How can researchers effectively analyze the folding and stability of UPF0053 protein yqhB?

Analyzing the folding and stability of UPF0053 protein yqhB presents unique challenges due to its transmembrane nature. Effective approaches combine biophysical techniques with functional assays:

Biophysical Approaches:

  • Thermal Shift Assays: Modified specifically for membrane proteins using fluorescent dyes that interact with exposed hydrophobic regions. Temperature gradients reveal the protein's thermal stability and can assess the impact of different detergents or lipid environments.

  • Limited Proteolysis: Properly folded membrane proteins show characteristic proteolytic patterns when subjected to controlled digestion. Time-course analysis combined with mass spectrometry can identify stable domains and flexible regions.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): This technique assesses protein homogeneity and oligomeric state, crucial parameters for membrane proteins that often function as oligomers.

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can report on local environments within the protein structure. Changes in fluorescence spectra under varying conditions provide insights into folding dynamics.

Functional Stability Assays:

  • Activity Retention Analysis: If a functional assay for yqhB is established, measuring activity retention after exposure to varying temperatures, pH conditions, or denaturants provides practical stability information.

  • Membrane Incorporation Efficiency: For proteins like yqhB, stability often correlates with proper membrane incorporation. Techniques such as membrane fractionation followed by western blotting can quantify this parameter.

Implementation Strategy:

For recombinant yqhB expressed in either E. coli or B. subtilis systems, a systematic analysis would include:

  • Initial detergent screening to identify conditions that maintain native-like structure

  • Stability comparisons between protein expressed in different systems (E. coli vs. B. subtilis)

  • Assessment of how fusion tags (such as the N-terminal 10xHis-tag) affect stability

  • Evaluation of stabilizing additives or lipids that might enhance folding

The challenge of distinguishing between properly folded and misfolded states for membrane proteins often requires combining multiple analytical approaches rather than relying on a single technique .

What are the recommended purification protocols for obtaining high-quality UPF0053 protein yqhB samples for structural studies?

Purifying high-quality UPF0053 protein yqhB for structural studies requires specialized protocols that maintain the integrity of this transmembrane protein. A comprehensive purification strategy should follow these steps:

Table 3: Recommended Purification Protocol for UPF0053 protein yqhB

Purification StageMethodologyCritical Parameters
Cell LysisMechanical disruption (French press or sonication)Buffer containing stabilizing agents and protease inhibitors
Membrane IsolationUltracentrifugation (100,000×g, 1h)Complete separation from cytosolic proteins
Membrane Protein ExtractionDetergent solubilizationScreening multiple detergents (DDM, LMNG, etc.)
Primary PurificationIMAC using Ni-NTA resinOptimized imidazole gradient for His-tagged protein
Intermediate PurificationIon exchange chromatographySalt gradient optimization based on pI
PolishingSize exclusion chromatographyAssessment of homogeneity and oligomeric state
Quality ControlSDS-PAGE, Western blot, Mass spectrometryPurity assessment and identity confirmation

Critical Considerations:

  • Detergent Selection: The choice of detergent is crucial for maintaining native structure. For initial extraction, milder detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are recommended, followed by systematic screening of alternatives.

  • Buffer Optimization: The recombinant yqhB has been reported to be stable in Tris/PBS-based buffers at pH 8.0, often supplemented with 6% trehalose as a stabilizing agent . Further optimization might include:

    • Addition of glycerol (10-20%) to enhance stability

    • Inclusion of specific lipids that mimic the native membrane environment

    • Addition of reducing agents if the protein contains cysteine residues

  • Tag Removal: While the N-terminal 10xHis-tag facilitates purification, it may interfere with structural studies. Incorporation of a specific protease cleavage site (TEV or PreScission) allows tag removal after initial purification.

  • Advanced Approaches for Structural Studies:

    • Reconstitution into nanodiscs or amphipols for cryo-EM studies

    • Lipidic cubic phase (LCP) preparation for crystallization attempts

    • Detergent exchange protocols for NMR studies

  • Storage Conditions: Purified yqhB should be stored at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles. Lyophilization in the presence of trehalose can extend shelf life to approximately 12 months .

The final quality of the purified protein should be assessed not only by purity criteria but also by functional assays to confirm that the native structure has been preserved throughout the purification process .

How can UPF0053 protein yqhB research contribute to our understanding of Bacillus subtilis membrane biology?

Research on UPF0053 protein yqhB has significant potential to advance our understanding of B. subtilis membrane biology in several key areas:

  • Membrane Protein Trafficking: As a transmembrane protein, yqhB may serve as a model for studying how B. subtilis synthesizes, folds, and inserts proteins into its membrane. This process involves the action of molecular chaperones and insertion machinery that remain incompletely characterized .

  • Membrane Compartmentalization: Recent research has shown that bacterial membranes are more compartmentalized than previously thought. Studying the localization and dynamics of yqhB could reveal patterns of membrane organization in B. subtilis.

  • Signaling Networks: While not directly referenced in the provided sources, transmembrane proteins often function in signaling networks. YqhB might interact with two-component systems like WalRK, potentially contributing to cell wall homeostasis or other essential cellular processes .

  • Evolutionary Conservation: The UPF0053 family is conserved across different bacterial species, suggesting an important functional role. Comparative studies between yqhB and homologs in other bacteria could reveal evolutionary adaptations in membrane biology.

Future research should employ systems biology approaches to place yqhB within the broader context of B. subtilis membrane function. This could include:

  • Interactome mapping to identify protein-protein interactions

  • Lipidomic analysis to determine if yqhB affects membrane lipid composition

  • Transcriptomic and proteomic profiling under conditions where yqhB expression is altered

  • Cryoelectron tomography to visualize membrane organization in the presence and absence of yqhB

Understanding these fundamental aspects of bacterial membrane biology has implications beyond basic science, potentially informing the development of new antimicrobial strategies or improving B. subtilis as a platform for recombinant protein production .

What genetic engineering approaches can be used to study UPF0053 protein yqhB function in Bacillus subtilis?

Investigating UPF0053 protein yqhB function requires sophisticated genetic engineering approaches tailored to B. subtilis biology:

Table 4: Genetic Engineering Strategies for yqhB Functional Analysis

ApproachMethodologyExpected Insights
Gene DeletionCRISPR-Cas9 or homologous recombinationEssential nature and global phenotypic effects
Conditional ExpressionXylose or IPTG-inducible promotersGrowth-phase dependent function
Protein TaggingFluorescent protein fusions (GFP, mCherry)Subcellular localization and dynamics
Domain MutagenesisSite-directed mutagenesis of key residuesStructure-function relationships
Complementation StudiesExpression of heterologous homologsEvolutionary conservation of function
Transcriptional ReportersPromoter-reporter fusionsRegulation of yqhB expression

Implementation Considerations:

  • Genome Minimization Context: Recent advances in B. subtilis engineering have produced genome-minimized strains lacking extracellular proteases, prophages, and sporulation genes. These strains provide an excellent background for yqhB studies, as they eliminate confounding factors and improve experimental reproducibility .

  • CRISPR-Cas9 Applications: While not specifically mentioned in the provided sources, CRISPR-Cas9 systems have been adapted for B. subtilis and can enable:

    • Precise deletion of yqhB without marker integration

    • Introduction of point mutations to test specific amino acid functions

    • Multiplex gene editing to study yqhB in combination with related genes

  • Synthetic Biology Approaches: For a comprehensive understanding of yqhB function, synthetic biology techniques can be employed to:

    • Create chimeric proteins with domains from related transporters

    • Develop biosensors that report on yqhB activity

    • Establish orthogonal expression systems for controlled studies

  • Bacterial Two-Hybrid Analysis: The BACTH system described in source represents a powerful approach to identify interaction partners of yqhB. This technique allows for systematic screening of potential interactors, providing insights into functional networks.

When implementing these approaches, researchers should be aware of potential challenges specific to membrane proteins, including:

  • Toxicity when overexpressed

  • Artifacts from protein tagging that may disrupt membrane localization

  • Difficulty interpreting phenotypes due to potential pleiotropic effects

The combination of multiple genetic approaches, rather than relying on a single technique, will likely provide the most comprehensive understanding of yqhB function .

What are the most significant research gaps in our understanding of UPF0053 protein yqhB and how might they be addressed?

Current research on UPF0053 protein yqhB reveals several significant knowledge gaps that represent important opportunities for future investigation:

  • Functional Characterization: The fundamental function of yqhB remains uncharacterized, as reflected in its UPF (Uncharacterized Protein Family) designation. This represents the most significant research gap that could be addressed through:

    • Systematic phenotypic analysis of deletion mutants under diverse conditions

    • Transport assays to test potential substrates

    • Proteomic analysis of interaction partners

    • Comparative genomics across species with yqhB homologs

  • Structural Determination: Despite the availability of the amino acid sequence, the three-dimensional structure of yqhB has not been elucidated. This gap limits our understanding of structure-function relationships and could be addressed through:

    • Cryo-EM studies of purified protein in membrane mimetics

    • X-ray crystallography of stabilized protein

    • Computational structural prediction validated by experimental data

  • Regulatory Networks: The potential involvement of yqhB in cell wall homeostasis and its relationship to regulatory systems like WalRK remains unexplored. This could be investigated through:

    • Transcriptional profiling in WalRK depletion strains

    • Chromatin immunoprecipitation to identify regulators binding to the yqhB promoter

    • Genetic suppressor screens to identify functional pathways

  • Biotechnological Applications: While B. subtilis has been extensively optimized as a protein production platform, the specific applications of yqhB in biotechnology remain unexplored. Potential approaches include:

    • Investigating whether yqhB overexpression impacts heterologous protein secretion

    • Testing yqhB as a fusion partner for difficult-to-express membrane proteins

    • Exploring applications in genome-minimized strains

Addressing these research gaps requires multidisciplinary approaches combining genetic, biochemical, structural, and computational methods. The rapid evolution of techniques for membrane protein analysis, together with advances in B. subtilis engineering, provides an excellent opportunity to resolve these outstanding questions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.