Recombinant Bacillus subtilis UPF0053 protein yrkA (yrkA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yrkA; BSU26610; UPF0053 protein YrkA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yrkA
Target Protein Sequence
MTTINLIIFTLLIVLTAFFVATEFAIVKIRSSKIDQLILEGKKGAISAKKVITHLDEYLS ACQLGITVTALGIGWVGESTFEVILHPLFAHFHVSETVSHVLILVIAFVMATFLHVVVGE LAPKTLAIQKAETITLLTAKPIIWFYRILFPFIWFLNGSARFIVGLFGLKPASEHELAHS EEELRILLSESYKSGEINQNELKYVNNIFEFDERIAKEIMIPRREIVAISSEDSYETIVK IIKTESYTRYPVLNGDKDSIIGFINAKEFLSAYIDTDQKIKEDFKLENHINPVIHVIESV PIHDVLVKMQKERTHIAILVDEYGGTSGLVTAEDILEEIVGEIRDEFDKDEVPNIRKVND NHYILDSKVLIEDVNDLLGTTLASDEVDTIGGWFMTQQIDAAVGSVIEADGYIFKVHETV GRHINYLEIVRKKE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the recombinant expression of yrkA protein compare to its native expression in B. subtilis?

Recombinant expression of yrkA protein introduces several important differences compared to its native expression:

  • Expression levels: Recombinant systems typically produce significantly higher quantities of the target protein compared to native expression. While native yrkA is expressed at relatively low levels in B. subtilis, recombinant systems can increase yield by orders of magnitude using optimized promoters and expression conditions .

  • Post-translational modifications: When expressed in heterologous systems such as E. coli, the protein may lack specific post-translational modifications that occur in B. subtilis. This can affect protein folding, membrane insertion, and functional activity .

  • Subcellular localization: In native conditions, yrkA is integrated into the membrane through specific cellular machinery. Recombinant expression, particularly in E. coli, may result in inclusion body formation rather than proper membrane integration, necessitating specialized extraction and refolding protocols .

  • Functional differences: Native yrkA operates within the context of the B. subtilis cellular environment, whereas recombinant yrkA exists in an artificial system that may not reproduce all necessary cofactors, chaperones, or interaction partners required for full functionality.

Researchers should carefully consider these differences when interpreting experimental results from recombinant yrkA studies and validate findings with complementary approaches when possible.

What expression systems are most effective for recombinant production of yrkA protein?

Several expression systems can be employed for recombinant production of yrkA protein, each with distinct advantages:

  • Bacillus subtilis homologous expression:

    • Maintains native cellular environment and machinery

    • Enables proper membrane integration and folding

    • Provides appropriate post-translational modifications

    • Various promoter systems are available, including IPTG-inducible P<sub>grac</sub> and self-inducible P<sub>srfA</sub> systems

  • E. coli-based expression:

    • Higher yields and faster growth rates

    • Well-established protocols and genetic tools

    • May require fusion partners (e.g., thioredoxin) to enhance solubility

    • Typically results in cytoplasmic expression rather than membrane integration

  • Mammalian cell expression:

    • Provides complex post-translational modifications

    • Often yields properly folded proteins

    • Lower expression levels but higher biological activity

    • More expensive and technically demanding

For membrane proteins like yrkA, the B. subtilis expression system offers significant advantages in maintaining native structural characteristics. Recent advances in B. subtilis expression technology have made it increasingly viable as both a research and industrial platform for membrane protein production .

Comparison of Expression Systems for yrkA Production:

Expression SystemYieldMembrane IntegrationPost-translational ModificationsCostTechnical Complexity
B. subtilisMediumExcellentNativeMediumMedium
E. coliHighPoorLimitedLowLow
Mammalian cellsLowGoodExtensiveHighHigh

What purification strategies are most effective for isolating recombinant yrkA protein?

Purification of yrkA protein presents challenges typical of membrane proteins. The following strategies have proven effective:

  • Affinity-based purification:

    • Histidine-tagged yrkA can be purified using nickel affinity chromatography

    • Other fusion tags such as MBP (maltose binding protein) or FLAG can enhance solubility and facilitate purification

    • Two-step purification combining affinity chromatography with size-exclusion chromatography can yield >95% purity

  • Membrane protein-specific strategies:

    • Detergent solubilization using mild non-ionic detergents (DDM, LDAO)

    • Gentle extraction conditions to maintain native conformation

    • Lipid nanodiscs or amphipols can be used to maintain protein stability post-purification

  • Scale-up considerations:

    • Batch purification is preferable for initial screening

    • FPLC (Fast Protein Liquid Chromatography) enables more controlled purification for larger scales

    • Automated systems can increase reproducibility for multiple purification runs

A typical purification protocol would involve:

  • Cell lysis under conditions optimized for membrane proteins

  • Detergent solubilization of membrane fractions

  • Affinity chromatography using the fusion tag

  • Optional tag removal if necessary for downstream applications

  • Size exclusion chromatography for final polishing

  • Buffer exchange into a stabilizing formulation

The purification approach should be tailored to the intended downstream applications, with consideration for maintaining the protein's native structure and function .

What are the optimal storage conditions to maintain stability of recombinant yrkA protein?

The stability of recombinant yrkA protein is crucial for maintaining its structural integrity and functional activity. Based on established protocols for similar membrane proteins and specific guidelines for yrkA:

  • Short-term storage (1-7 days):

    • Store at 4°C in appropriate buffer (typically Tris-based)

    • Include 50% glycerol as a stabilizing agent

    • Avoid repeated freeze-thaw cycles which can lead to protein denaturation

  • Medium-term storage (weeks to months):

    • Store at -20°C in aliquots to avoid repeated freeze-thaw cycles

    • Include cryoprotectants such as glycerol (50%)

    • Maintain in buffer optimized specifically for yrkA stability

  • Long-term storage (months to years):

    • Store at -80°C

    • Prepare small working aliquots to minimize freeze-thaw cycles

    • Consider lyophilization for extended stability, though this may affect membrane protein structure

  • Buffer composition considerations:

    • Tris-based buffers at pH 7.4-8.0 are typically suitable

    • Include stabilizing agents such as glycerol

    • For membrane proteins like yrkA, detergents at concentrations above critical micelle concentration (CMC) may be necessary to maintain solubility

    • Consider adding reducing agents like DTT or β-mercaptoethanol to prevent disulfide bond formation

Stability monitoring through SDS-PAGE and activity assays should be performed periodically to ensure the protein maintains its integrity throughout the storage period.

How can researchers effectively verify the functional activity of recombinant yrkA protein?

Verifying the functional activity of recombinant yrkA protein is essential to ensure that experimental results reflect biologically relevant properties. Since the specific function of yrkA is not fully characterized, researchers should employ multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to evaluate proper folding

    • Size-exclusion chromatography to confirm monodispersity

  • Membrane integration verification:

    • Liposome reconstitution assays

    • Fluorescence microscopy with labeled protein to visualize membrane localization

    • Protease protection assays to confirm proper topology

  • Functional assays:

    • Protein-protein interaction studies with known or predicted partners

    • Complementation assays in yrkA knockout B. subtilis strains

    • Comparison of phenotypes between wild-type and recombinant protein

  • Activity-specific assays:

    • If specific enzymatic activity is identified, develop appropriate biochemical assays

    • Monitor changes in membrane potential or ion flux if yrkA functions as a transporter

    • Assess binding to specific ligands using techniques such as isothermal titration calorimetry (ITC)

The implementation of these verification methods will depend on the specific research questions being addressed and should be adapted based on emerging information about yrkA's biological function.

What approaches can be used to study protein-protein interactions involving yrkA?

Understanding protein-protein interactions is crucial for elucidating yrkA's function within cellular networks. Several complementary techniques can be employed:

  • In vitro interaction methods:

    • Pull-down assays using tagged recombinant yrkA

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interaction studies with minimal protein consumption

  • In vivo interaction approaches:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

    • Co-immunoprecipitation from B. subtilis cells expressing tagged yrkA

    • Proximity labeling methods such as BioID or APEX2 to identify proximal proteins

  • Systems biology methods:

    • Interactome mapping through mass spectrometry-based approaches

    • Genetic interaction screens in B. subtilis

    • Suppressor mutation analysis to identify functional relationships

  • Structural biology approaches:

    • Cryo-electron microscopy of protein complexes

    • X-ray crystallography of yrkA with interacting partners

    • NMR studies for dynamic interaction interfaces

When designing interaction studies, researchers should consider the membrane-associated nature of yrkA, which may require specialized approaches to maintain protein stability and native conformation during experimental procedures.

How can site-directed mutagenesis be used to study functional domains in yrkA protein?

Site-directed mutagenesis represents a powerful approach to dissect structure-function relationships in yrkA protein. Based on sequence analysis and structural predictions, researchers can systematically target key residues:

  • Strategic mutation design:

    • Target conserved residues identified through sequence alignment of UPF0053 family proteins

    • Focus on predicted functional motifs, particularly within transmembrane regions

    • Investigate charged residues that may participate in ion transport or protein-protein interactions

    • Create alanine-scanning libraries across regions of interest

  • Mutagenesis protocol optimization:

    • For B. subtilis expression, implement recombineering approaches

    • Design overlapping PCR primers with appropriate mismatches

    • Consider Gibson Assembly for efficient construct generation

    • Verify mutations through sequencing before expression

  • Functional analysis of mutants:

    • Compare expression levels and membrane localization of mutants to wild-type

    • Assess changes in protein stability through thermal shift assays

    • Evaluate alterations in interaction profiles

    • If specific activity is known, measure kinetic parameters of mutant proteins

  • Structure-function mapping:

    • Correlate mutation effects with structural models

    • Generate comprehensive mutation libraries for high-throughput functional screening

    • Implement deep mutational scanning if appropriate high-throughput assays are available

Table: Priority Residues for Site-Directed Mutagenesis in yrkA

Residue PositionPredicted FunctionMutation StrategyExpected Effect
Transmembrane domainsMembrane anchoringHydrophobic to chargedDisruption of membrane integration
Conserved motifsStructural/functionalAlanine substitutionLoss of specific activity
Charged residuesElectrostatic interactionsCharge reversalAltered protein-protein interactions
Post-translational modification sitesRegulationNon-modifiable substitutionsChanges in regulatory response

What are the challenges in scaling up production of recombinant yrkA protein for structural studies?

Structural biology studies typically require milligram quantities of highly pure, homogeneous protein, presenting several challenges for membrane proteins like yrkA:

  • Expression scale-up challenges:

    • Maintaining consistent expression levels in larger culture volumes

    • Optimizing induction timing and concentration for maximum yield

    • Balancing expression rate with proper membrane integration

    • Implementing fed-batch or continuous culture strategies for B. subtilis

  • Purification bottlenecks:

    • Scaling up detergent extraction while maintaining cost-effectiveness

    • Preventing protein aggregation during concentration steps

    • Achieving homogeneity required for crystallization trials

    • Removing all traces of contaminating proteins that may interfere with structural studies

  • Stability considerations:

    • Identifying buffer conditions that maintain stability during extended purification procedures

    • Preventing oxidation or proteolytic degradation

    • Finding compatible detergents or membrane mimetics for structural studies

    • Minimizing batch-to-batch variation

  • Technical approaches to address challenges:

    • Screen multiple expression constructs with different fusion tags or truncations

    • Implement high-throughput purification screening to identify optimal conditions

    • Consider nanodiscs, amphipols, or lipidic cubic phase for stabilization

    • Explore co-expression with stabilizing binding partners

For B. subtilis expression specifically, researchers can leverage recent advances in genetic engineering such as CRISPR-Cas9 technologies for strain optimization and promoter engineering to enhance expression yields while maintaining proper folding .

How can researchers address inclusion body formation when expressing recombinant yrkA?

Inclusion body formation is a common challenge when expressing membrane proteins like yrkA, particularly in E. coli systems. Several strategies can address this issue:

  • Prevention strategies:

    • Lower the expression temperature (16-25°C) to slow protein synthesis and allow proper folding

    • Reduce inducer concentration to decrease expression rate

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist folding

    • Use fusion partners known to enhance solubility (MBP, thioredoxin, SUMO)

    • Consider expression in B. subtilis as the native host to promote proper folding and membrane integration

  • Extraction and refolding approaches:

    • Isolate inclusion bodies using differential centrifugation

    • Solubilize using strong denaturants (8M urea or 6M guanidine hydrochloride)

    • Implement stepwise dialysis for gradual refolding

    • Include appropriate detergents during refolding to facilitate membrane protein folding

    • Add mild oxidizing and reducing agents to promote proper disulfide bond formation

  • Alternative expression strategies:

    • Cell-free expression systems with the addition of detergents or lipids

    • Periplasmic expression in E. coli to benefit from the oxidizing environment

    • Expression as fragments to identify soluble domains

    • Creating chimeric constructs with well-folded soluble proteins

  • Analytical methods to monitor folding:

    • Fluorescence spectroscopy to assess tertiary structure

    • Circular dichroism to evaluate secondary structure elements

    • Limited proteolysis to compare folding states

    • Size-exclusion chromatography to detect aggregation

By systematically applying these approaches, researchers can significantly improve the yield of correctly folded yrkA protein for downstream applications.

What are the best practices for troubleshooting low yield in recombinant yrkA expression?

Low yield of recombinant yrkA can result from multiple factors throughout the expression and purification process. Systematic troubleshooting should address:

  • Expression vector optimization:

    • Verify promoter strength and inducibility

    • Check codon optimization for the expression host

    • Ensure correct reading frame and absence of premature stop codons

    • Consider using different affinity tags or fusion partners

    • Test multiple promoter systems, particularly those optimized for B. subtilis

  • Culture condition refinement:

    • Optimize cell density at induction (typically OD<sub>600</sub> 0.6-0.8)

    • Test various induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Adjust inducer concentration and induction duration

    • Explore different media formulations and supplement with trace elements

    • For B. subtilis, consider self-inducible expression systems which can yield up to 14.6% of total cellular protein

  • Cell lysis and extraction improvements:

    • Optimize lysis buffer composition (detergents, salt concentration)

    • Test different mechanical disruption methods (sonication, homogenization, bead-beating)

    • Implement enzymatic lysis cocktails specific for B. subtilis cell walls

    • Separate membrane fractions effectively before detergent solubilization

  • Purification process enhancement:

    • Screen multiple detergents for efficient extraction

    • Optimize binding conditions for affinity chromatography

    • Reduce non-specific binding through buffer additives

    • Minimize protein loss during concentration steps

Systematic Yield Optimization Table:

StageParameterRange to TestMonitoring Method
ExpressionInduction OD0.4-1.0SDS-PAGE analysis
ExpressionTemperature16-37°CWestern blot
ExpressionInducer concentration0.1-1.0 mM IPTGFluorescence (if tagged)
LysisDetergent typeDDM, LDAO, Triton X-100Solubilization efficiency
PurificationImidazole concentration10-40 mM (wash)Purity by SDS-PAGE
PurificationElution conditionspH, imidazole gradientRecovery percentage

Implementing a design of experiments (DOE) approach can efficiently identify optimal conditions across multiple parameters simultaneously.

What are the future research directions for studying recombinant yrkA protein?

The study of yrkA protein represents an evolving research area with several promising directions for future investigation:

  • Functional characterization:

    • Comprehensive phenotypic analysis of yrkA knockout strains

    • Identification of specific substrates or binding partners

    • Elucidation of regulatory networks controlling yrkA expression

    • Development of activity assays based on emerging functional data

  • Structural biology advances:

    • High-resolution structure determination through cryo-EM or X-ray crystallography

    • Membrane topology mapping through accessibility studies

    • Conformational dynamics studies using hydrogen-deuterium exchange

    • In silico modeling and molecular dynamics simulations

  • Biotechnological applications:

    • Exploration of potential industrial applications based on function

    • Development as a model system for membrane protein expression in B. subtilis

    • Engineering of yrkA variants with enhanced stability or activity

    • Integration into synthetic biology circuits in B. subtilis

  • Comparative biology approaches:

    • Analysis of UPF0053 family proteins across bacterial species

    • Evolutionary studies to trace functional conservation

    • Identification of structurally related proteins with known functions

As research progresses, the integration of multi-omics approaches (genomics, transcriptomics, proteomics, and metabolomics) will likely provide comprehensive insights into yrkA's biological role and potential applications in both basic research and biotechnology contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.