Recombinant Bacillus subtilis UPF0059 membrane protein ywlD (ywlD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your request when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; ywlD; BSU36940; ipc-30d; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mntP
Target Protein Sequence
MSDLFIGELITLSIMAFALGMDAFSVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMA AGNMLSGLLGVLAVYIGGALLFVLGVQMLMASFKQSEERFMSPAGPGLLLFAIGVSLDSF SVGLSLGIYGSHPLLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGLK LLLPI
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ywlD protein and how is it classified?

The ywlD protein is an uncharacterized membrane protein (UPF0059 family) from Bacillus subtilis, a model organism for Gram-positive bacteria. Similar to other membrane proteins in B. subtilis, ywlD likely plays a role in cellular processes involving the membrane. B. subtilis serves as a model organism for other Firmicutes and is popular in microbiology research due to its fast growth and ease of genetic manipulation . The UPF0059 designation indicates this protein belongs to a family with unknown function, making it a potential target for novel discoveries in membrane protein biology.

What expression systems are most effective for recombinant production of ywlD?

For recombinant expression of B. subtilis membrane proteins like ywlD, several systems have demonstrated efficacy with considerations for each:

  • Homologous expression in B. subtilis: Often preferred due to native membrane composition and processing machinery. B. subtilis can easily take up foreign DNA and integrate it into its genome, making it suitable for genetic manipulation .

  • E. coli-based expression: Based on the successful expression of other B. subtilis membrane proteins in E. coli, this system can be effective. For example, both SpoIIIJ and YqjG (B. subtilis membrane proteins) have been successfully expressed in E. coli, suggesting similar approaches might work for ywlD .

  • Cell-free expression systems: Useful for toxic membrane proteins that may disrupt host cellular processes.

How does the genetic context of ywlD influence experimental design?

When designing experiments involving ywlD, consider its genetic context:

  • Neighboring genes may provide functional clues through potential operonic structures

  • Promoter analysis is crucial, as expression patterns can indicate function (similar to how yfkJ and ywlE show different expression patterns during growth phases)

  • Regulatory elements should be examined, as they may control expression under specific conditions

Transcriptional analysis of other B. subtilis membrane-associated proteins has revealed distinct expression patterns during different growth phases and stress conditions. For example, the promoter region of ywlE shows activity that drives transcription in a growth-dependent pattern . Similar analysis of ywlD's promoter region could reveal important regulatory mechanisms.

What purification strategies are recommended for recombinant ywlD?

Purification of membrane proteins like ywlD requires specialized approaches:

Table 1: Recommended Purification Protocol for Recombinant ywlD

StepProcedureCritical ParametersNotes
1Membrane isolationGentle cell lysis; buffer composition pH 7.5-8.0Avoid harsh detergents that may destabilize the protein
2SolubilizationTest panel of detergents (DDM, LMNG, etc.)Screen 6-8 detergents at varying concentrations
3Affinity purificationImidazole gradient for His-tagged constructsMonitor elution profile carefully
4Size exclusionBuffer containing stabilizing detergentAssess oligomeric state
5Quality assessmentSDS-PAGE, Western blotting, and activity assaysConfirm purity and identity

The choice of detergent is crucial for membrane protein purification. Studies with other B. subtilis membrane proteins have shown that mild detergents that maintain protein-protein interactions are often preferred, especially if ywlD forms complexes with other proteins similar to how SpoIIIJ and YqjG associate with the F1Fo ATP synthase complex .

How can I create and validate knockout mutants of ywlD in B. subtilis?

Creating knockout mutants requires careful consideration of potential polar effects:

  • Design a non-polar deletion strategy, similar to approaches used for other B. subtilis membrane proteins

  • Use integration vectors carrying an antibiotic resistance marker

  • Confirm deletion by PCR and sequence verification

  • Validate the knockout phenotype through complementation experiments

When analyzing phenotypes, examine growth under various conditions, stress responses, and membrane integrity. For example, deletion of other membrane-associated proteins in B. subtilis has been shown to affect stress resistance, particularly to ethanol . Similar phenotypic analyses could reveal the functional role of ywlD.

What methods are effective for studying membrane protein localization for ywlD?

To determine the subcellular localization of ywlD:

  • Fluorescent protein fusions (GFP/mCherry) can visualize localization in vivo

  • Immunofluorescence microscopy using specific antibodies

  • Cell fractionation and Western blotting to confirm membrane association

  • Protease accessibility assays to determine membrane topology

Modern microscopy techniques have advanced our understanding of membrane protein dynamics in B. subtilis. For example, early studies with MreB-GFP fusions suggested helical filaments along the cell membrane, but newer techniques revealed dynamic patches requiring active peptidoglycan synthesis . Similar approaches could reveal dynamic aspects of ywlD localization.

How might ywlD function in membrane protein biogenesis?

Based on studies of other B. subtilis membrane proteins, ywlD may function in membrane protein insertion or assembly:

  • Other B. subtilis membrane proteins like SpoIIIJ and YqjG function similarly to YidC in E. coli, facilitating membrane protein insertion

  • These proteins can complement YidC depletion in E. coli and are involved in SecYEG-dependent and -independent membrane insertion

  • ywlD may similarly participate in membrane protein biogenesis pathways

To test this hypothesis, researchers could:

  • Express ywlD in YidC-depleted E. coli to test for complementation

  • Examine membrane insertion of model substrates (like F1Fo ATP synthase subunits) in the presence and absence of ywlD

  • Use pull-down assays to identify potential interaction partners involved in protein translocation

The finding that SpoIIIJ and YqjG facilitate membrane insertion of F1Fo ATP synthase subunit c suggests potential experimental approaches for investigating ywlD function .

What protein-protein interactions might reveal ywlD function?

Investigating protein-protein interactions can provide valuable insights into ywlD function:

Table 2: Approaches for Identifying ywlD Interaction Partners

MethodAdvantagesLimitationsKey Controls
Co-immunoprecipitationIdentifies native interactionsRequires specific antibodiesEmpty vector, irrelevant membrane protein
Bacterial two-hybridScreens many potential partnersMay miss transient interactionsPositive/negative controls, verification by alternative methods
Crosslinking mass spectrometryCaptures transient interactionsComplex data analysisNon-crosslinked samples
Pull-down with ATP synthase componentsTests specific hypothesisLimited to targeted interactionsUse of unrelated membrane proteins as controls

SpoIIIJ and YqjG, two B. subtilis Oxa1p homologs, have been found to associate with the entire F1Fo ATP synthase complex, suggesting a role in the membrane assembly process . Similar approaches could reveal whether ywlD associates with specific membrane protein complexes.

How does stress affect ywlD expression and function?

Understanding stress responses can provide important functional insights:

  • Design experiments to examine ywlD expression under various stress conditions (heat, ethanol, salt, antibiotics)

  • Use promoter-reporter fusions to monitor transcriptional responses, similar to approaches used for yfkJ and ywlE

  • Analyze growth and survival of ywlD deletion mutants under stress conditions

Other B. subtilis membrane-associated proteins show stress-dependent regulation. For example, yfkJ transcription is upregulated in a σB-dependent manner during ethanol stress, while ywlE shows growth-dependent but ethanol-insensitive expression . Similar analysis of ywlD could reveal its role in stress responses.

How can bioinformatics approaches help predict ywlD function?

Computational approaches can provide valuable insights for uncharacterized proteins:

  • Sequence-based analyses:

    • Multiple sequence alignments with homologs across species

    • Identification of conserved domains or motifs

    • Prediction of transmembrane segments and topology

  • Structure-based approaches:

    • Homology modeling based on structurally characterized proteins

    • Molecular dynamics simulations to study membrane interactions

    • Docking studies with potential interacting partners

  • Omics data integration:

    • Analysis of co-expression networks

    • Examination of transcriptomic responses under various conditions

    • Incorporation of proteomics data on membrane protein complexes

Databases like SubtiWiki integrate different types of information about B. subtilis in an intuitive manner, which is essential for developing novel research hypotheses . These resources can help place ywlD in its biological context.

How do I interpret contradictory results from functional studies of ywlD?

When faced with conflicting data:

  • Systematically evaluate experimental conditions that differ between studies

  • Consider strain background effects and potential compensatory mechanisms

  • Examine whether different domains of ywlD may have distinct functions

  • Test whether ywlD has conditional functions depending on growth phase or stress conditions

It's important to note that B. subtilis contains proteins with redundant functions. For example, SpoIIIJ and YqjG appear to be mutually exchangeable for many functions, though SpoIIIJ is specifically required for spore formation . Similar redundancy might explain contradictory results in ywlD studies.

What are common pitfalls in membrane protein expression and purification?

Researchers working with membrane proteins like ywlD should be aware of these challenges:

  • Low expression levels: Optimize codon usage, promoter strength, and induction conditions

  • Protein misfolding: Test various expression temperatures and host strains

  • Toxicity to host cells: Consider inducible systems or lower copy number vectors

  • Aggregation during purification: Screen multiple detergents and buffer conditions

  • Loss of function during purification: Include stability assays at each purification step

When studying ywlD function, it's important to consider that B. subtilis membrane proteins may require specific lipid environments or protein partners for proper function, as suggested by studies showing that SpoIIIJ and YqjG associate with the F1Fo ATP synthase complex in vivo .

How can I design controls for functional studies of an uncharacterized protein?

Robust experimental design requires appropriate controls:

Table 3: Essential Controls for ywlD Functional Studies

Experiment TypePositive ControlNegative ControlAdditional Controls
Gene deletionComplementation with ywlDEmpty vectorExpression of related proteins (if known)
Protein-protein interactionsKnown interacting pairsUnrelated membrane proteinCompetition assays
Membrane insertion assaysKnown YidC substrateYidC-depleted conditionsUse of both E. coli and B. subtilis substrates
Stress responseKnown stress-responsive geneConstitutive promoterTesting multiple stress conditions

The experimental approach used to study other B. subtilis membrane proteins provides a template. For example, when studying the role of SpoIIIJ and YqjG in membrane insertion, researchers used well-characterized substrates like F1Fo ATP synthase subunit c from both E. coli and B. subtilis .

What emerging technologies might advance ywlD research?

Several cutting-edge approaches could accelerate understanding of ywlD:

  • Cryo-electron microscopy for membrane protein structure determination

  • Native mass spectrometry to identify protein complexes

  • CRISPR-Cas9 gene editing for precise genomic modifications

  • Single-molecule techniques to study protein dynamics in membranes

  • Microfluidics-based approaches for high-throughput phenotypic analysis

These technologies could help resolve the function of ywlD within the complex context of B. subtilis membrane biology, similar to how modern microscopy techniques revealed new insights about MreB dynamics in B. subtilis .

How might ywlD research contribute to broader understanding of bacterial membrane biology?

Research on uncharacterized proteins like ywlD contributes to:

  • Identification of novel membrane protein biogenesis pathways

  • Understanding bacterial stress responses and adaptation mechanisms

  • Discovering new antimicrobial targets in Gram-positive bacteria

  • Characterizing the minimal set of essential membrane proteins

  • Advancing synthetic biology applications using B. subtilis as a chassis

B. subtilis has positioned itself at the leading edge for discovering new biological concepts and deepening our understanding of bacterial cell organization . Characterizing ywlD could reveal new aspects of membrane protein biology that extend beyond this specific protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.