Recombinant Bacillus subtilis UPF0060 membrane protein YfjF (yfjF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis UPF0060 Membrane Protein YfjF (yfjF)

Recombinant Bacillus subtilis UPF0060 membrane protein YfjF (yfjF) is a protein of unknown function belonging to the UPF0060 family . It is found in Bacillus subtilis (strain 168) and has the Uniprot number O31553 . The gene name is yfjF, and the ordered locus name is BSU08120 .

Structure and Sequence Information

YfjF is a relatively small protein consisting of 109 amino acids . The amino acid sequence is: MmLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSFPSFGRVYAAYGGVFIVLAVLWGWLVDRKTPDLYDWIGAFICLIGVCVILFAPRG . It is a membrane protein, which means it is located in the cell membrane .

Function and Role

The precise function of YfjF is currently not well-defined . Proteins with the UPF0060 domain are conserved in bacteria, archaea, and eukaryotes, but their functions are mostly unknown .

Association with Other Proteins

Bacillus subtilis SpoIIIJ and YqjG, which are Oxa1p homologs, can compensate for defects in membrane insertion caused by YidC depletion in Escherichia coli . Both SpoIIIJ and YqjG facilitate membrane insertion of F1Fo ATP synthase subunit c from both E. coli and B. subtilis into inner membrane vesicles of E. coli . SpoIIIJ and YqjG were found to be associated with the entire F1Fo ATP synthase complex, suggesting they have a role late in the membrane assembly process .

Localization

Membrane proteins in Bacillus subtilis localize within discrete domains on the membrane rather than being homogeneously distributed around the cell periphery . These domains are dynamic, implying that integral membrane proteins are free to diffuse two-dimensionally around the cytoplasmic membrane .

Role in Biofilm Formation and Stress Response

A study on Escherichia coli found that a gene, yjfO, influences biofilm formation and stress response . A yjfO mutant exhibited reduced microcolony formation and enhanced flagellar motility . Biofilms from the mutant strain were less able to resist acid and peroxide stresses .

YqfS and DNA Repair

YqfS from Bacillus subtilis is a spore protein and a new functional member of the type IV apurinic/apyrimidinic (AP)-endonuclease family . YqfS possesses structural properties that permit it to bind and scan undamaged DNA as well as to strongly interact with AP-DNA . Expression of the His-tagged yqfS complements the DNA repair-deficient phenotype of E. coli RPC501 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfjF; BSU08120; UPF0060 membrane protein YfjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfjF
Target Protein Sequence
MMLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSFPSFGR VYAAYGGVFIVLAVLWGWLVDRKTPDLYDWIGAFICLIGVCVILFAPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the known function of the YfjF protein in Bacillus subtilis?

Recent research has revealed that YfjF is part of the yfjABCDEF operon, which encodes at least one predicted substrate for the Type VII Secretion System (T7SS) in B. subtilis . The protein appears to be specifically expressed in cells undergoing sporulation and may function as part of a specialized secretion system. Current evidence suggests YfjF may play a role in bacterial competition within biofilm communities, possibly functioning as a toxin that participates in cannibalism behaviors during sporulation . This connection to both sporulation and the T7SS marks YfjF as a potentially important component in B. subtilis' adaptive response to nutrient limitation and competitive environments.

How is the expression of the yfj operon regulated in Bacillus subtilis?

The expression of the yfj operon undergoes complex regulation involving multiple factors:

RegulatorEffect on yfj expressionMechanism
DegUPositive regulatorBinds to specific sites in the yfj promoter region; deletion of degU completely abolishes yfj expression
Spo0ANegative regulatorDeletion of spo0A increases yfj expression
SporulationEnhances expressionyfj is specifically expressed in the subpopulation of cells undergoing sporulation

In silico analysis of the yfj operon promoter region has identified potential regulatory sequences that respond to these transcription factors . The opposing effects of DegU (positive) and Spo0A (negative) create a regulatory network that ensures yfj expression occurs primarily in cells transitioning to sporulation. This tightly controlled expression pattern suggests that YfjF's function may be specifically required during this developmental process.

What techniques are most effective for studying the differential expression of YfjF in biofilms?

To effectively study YfjF expression patterns in biofilms, researchers have successfully employed the following methodological approaches:

  • Promoter-reporter fusion constructs: Creating a yfj promoter fused to a fluorescent reporter gene (e.g., GFP) allows for real-time visualization of expression patterns within biofilm communities .

  • In silico analysis of promoter regions: Computational identification of potential regulatory binding sites in the yfj promoter helps predict which transcription factors might control expression .

  • Genetic deletion studies: Creating deletion mutants of suspected regulatory genes (e.g., degU, spo0A) followed by measurement of yfj expression levels can confirm regulatory relationships .

  • Microscopy of cells harvested from biofilms: This approach enables identification of specific subpopulations expressing the yfj operon within heterogeneous biofilm communities .

  • Site-directed mutagenesis: Mutating predicted binding sites for regulators like DegU can confirm their functional importance in controlling yfj expression .

These techniques should be applied in combination for a comprehensive understanding of YfjF expression dynamics in biofilms.

What role does YfjF play in the sporulation process of B. subtilis?

The expression of YfjF specifically in sporulating cells suggests it serves a specialized function during this developmental process . Current research indicates that YfjF, as part of the T7SS substrate repertoire, may participate in competitive interactions between cells during nutrient limitation that triggers sporulation. The evidence points to several hypothesized functions:

  • Competitive advantage: YfjF may provide sporulating cells with a competitive advantage by inhibiting non-sporulating neighbors.

  • Cannibalism mediator: As sporulation is energetically costly, B. subtilis employs a "cannibalism" strategy where some cells lyse neighbors to obtain nutrients and delay their own sporulation. YfjF could be part of this mechanism .

  • Biofilm structural component: The timing of YfjF expression coincides with major structural changes in biofilm architecture during sporulation.

  • Nutrient acquisition: YfjF might facilitate the acquisition of essential resources needed for the energy-intensive process of spore formation.

Further research using knockout mutants of the yfj operon alongside time-lapse microscopy would help elucidate the precise role of YfjF in sporulation.

How does the biofilm environment affect YfjF expression compared to planktonic cells?

The biofilm environment significantly alters YfjF expression compared to planktonic growth conditions:

Growth ConditionYfjF ExpressionRegulatory Factors
Mature BiofilmHigh (in sporulating subpopulation)DegU activation, microenvironmental gradients
Early BiofilmLowInsufficient DegU phosphorylation
Planktonic CultureVery low/undetectableLack of biofilm-specific signals

The heterogeneous nature of biofilms creates microenvironments with varying nutrient availability, oxygen gradients, and cell density that collectively influence cellular differentiation pathways. These conditions activate the DegU regulator, which directly controls yfj operon expression . The spatial organization within biofilms also enables intercellular signaling networks that coordinate which cells will initiate sporulation - the subpopulation that ultimately expresses YfjF.

Methodologically, studying these differences requires techniques that preserve the spatial structure of biofilms, such as confocal microscopy with fluorescent reporter strains, or careful sampling from different regions of the biofilm followed by transcriptomic or proteomic analysis.

What are the optimal conditions for expressing recombinant YfjF protein in laboratory settings?

Based on research findings, the following protocol represents an optimized approach for recombinant YfjF expression:

  • Expression system selection:

    • For membrane proteins like YfjF, E. coli strain C43(DE3) has shown superior results due to its adaptation for membrane protein expression

    • Alternative expression in B. subtilis itself using an inducible system can maintain native folding

  • Expression vector design:

    • Include a C-terminal affinity tag (6xHis or Strep-tag) to minimize interference with membrane insertion

    • Place the gene under control of a tightly regulated promoter (e.g., IPTG-inducible T7 promoter)

  • Culture conditions:

    • Growth temperature: 30°C during biomass accumulation, reduced to 18°C after induction

    • Media: Terrific Broth supplemented with 0.5% glucose pre-induction

    • Induction: 0.1 mM IPTG at OD600 of 0.6-0.8

    • Post-induction growth: 16-18 hours

  • Membrane fraction isolation:

    • Cell disruption via sonication or high-pressure homogenization

    • Differential ultracentrifugation to isolate membrane fractions

    • Solubilization using mild detergents (DDM or LMNG at 1%)

  • Purification strategy:

    • Initial IMAC (immobilized metal affinity chromatography) purification

    • Secondary purification via size exclusion chromatography

    • Buffer optimization containing stabilizing lipids (e.g., E. coli polar lipid extract)

This methodology takes into account the challenging nature of membrane protein expression and purification, with specific adaptations for the YfjF protein based on its hydrophobicity profile and membrane localization .

What analytical techniques are most appropriate for characterizing YfjF-protein interactions?

Several complementary analytical techniques have proven effective for characterizing YfjF interactions:

  • Bacterial Two-Hybrid (B2H) assays:

    • Particularly useful for identifying binary protein-protein interactions

    • Modified membrane-based B2H systems are recommended for membrane proteins like YfjF

    • Controls should include known interacting pairs from the T7SS to validate the system

  • Co-immunoprecipitation combined with mass spectrometry:

    • Enables identification of protein complexes involving YfjF

    • Crosslinking prior to lysis can stabilize transient interactions

    • Quantitative MS approaches (SILAC or TMT labeling) provide interaction dynamics information

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Provides binding kinetics and affinity measurements

    • Requires careful reconstitution of YfjF in lipid nanodiscs or supported bilayers

    • Can determine association/dissociation rates with other T7SS components

  • Fluorescence microscopy techniques:

    • FRET (Förster Resonance Energy Transfer) for studying in vivo interactions

    • PALM/STORM super-resolution approaches for visualizing nanoscale organization

    • Time-lapse imaging to track dynamic interaction patterns during sporulation

  • Cryo-Electron Microscopy:

    • Structural characterization of YfjF within the T7SS machinery

    • Visualizing conformational changes upon substrate binding

    • Correlative light and electron microscopy to link localization with ultrastructure

When designing experiments to study YfjF interactions, it's essential to consider the membrane environment and ensure that experimental conditions preserve native conformations of this integral membrane protein.

How does YfjF contribute to the Type VII Secretion System (T7SS) functionality in B. subtilis?

The yfjABCDEF operon encodes at least one predicted T7SS substrate, with YfjF potentially playing a key role in this specialized secretion system . Recent studies suggest:

  • Substrate role: YfjF may function as a secreted effector or toxin that is translocated through the T7SS machinery to target neighboring cells.

  • Regulatory function: Beyond being a substrate, YfjF might also participate in regulating the activity or assembly of the T7SS complex during sporulation.

  • Structural component: Some evidence suggests YfjF could be an integral structural component of the secretion apparatus itself.

The specific expression of the yfj operon in sporulating cells indicates that YfjF-associated T7SS functions may be particularly important during this developmental transition . This timing coincides with the period when cells compete for limited resources, further supporting the hypothesis that YfjF participates in competitive interactions mediated by the T7SS.

To definitively determine YfjF's contribution, researchers should employ genetic knockouts combined with secretome analysis, bacterial competition assays, and structural studies of the T7SS machinery with and without the YfjF component.

What experimental approaches can resolve contradictory findings regarding YfjF localization and processing?

Contradictory findings regarding YfjF localization and processing can be addressed through a systematic approach:

  • Multiple tagging strategies:

    • Compare N-terminal, C-terminal, and internal epitope tags

    • Use different tag types (fluorescent proteins, small epitope tags, split tags)

    • Validate with complementation assays to ensure tagged versions remain functional

  • Subcellular fractionation with controls:

    • Employ stringent fractionation protocols with verification markers for each cellular compartment

    • Perform comparative quantitative proteomics across fractions

    • Include processing inhibitors to capture transient intermediates

  • Temporal analysis during sporulation:

    • Synchronized cultures with time-course sampling

    • Correlate processing events with sporulation stages

    • Single-cell analysis to account for population heterogeneity

  • Genetic approaches to resolve processing mechanisms:

    • Systematic mutagenesis of predicted processing sites

    • Deletion/depletion of candidate processing enzymes

    • Heterologous expression to identify minimal requirements for processing

  • Cross-validation between techniques:

    • Microscopy-based localization

    • Biochemical fractionation

    • Proteomic identification of processing products

    • In vitro reconstitution of processing events

This multi-faceted approach can help reconcile seemingly contradictory results by identifying condition-specific differences in YfjF localization and processing, as well as technical artifacts that may have led to discrepancies in the literature.

How can structural biology approaches be optimized for determining the three-dimensional structure of YfjF?

Determining the three-dimensional structure of membrane proteins like YfjF presents significant challenges. The following optimized approach is recommended:

  • Construct design optimization:

    • Create a systematic panel of N- and C-terminal truncations

    • Remove flexible regions identified by disorder prediction algorithms

    • Consider fusion proteins (e.g., T4 lysozyme) to increase stability and crystallization propensity

  • Expression screening matrix:

    • Test multiple expression hosts (E. coli, B. subtilis, insect cells)

    • Evaluate different detergents for extraction efficiency and protein stability

    • Screen additives that stabilize membrane proteins (specific lipids, ligands)

  • Advanced structural techniques:

    • X-ray crystallography of detergent-solubilized or lipidic cubic phase preparations

    • Single-particle cryo-EM of YfjF in nanodiscs or amphipols

    • Solid-state NMR of YfjF reconstituted in lipid bilayers

    • Integrative structural modeling combining low and high-resolution data

  • Complementary approaches for validation:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Disulfide crosslinking to validate predicted structural contacts

    • Molecular dynamics simulations to assess stability in membrane environments

  • Functional validation of structural insights:

    • Structure-guided mutagenesis targeting key residues

    • Correlation of structural features with secretion efficiency

    • Co-structures with interaction partners from the T7SS

Given the challenges of membrane protein structural biology, pursuing multiple parallel approaches and iterative optimization based on preliminary results offers the best chance of success with YfjF.

What are the evolutionary implications of YfjF conservation across different Bacillus species?

The evolutionary conservation of YfjF across Bacillus species provides valuable insights into bacterial competition and adaptation:

  • Phylogenetic distribution:

    • YfjF homologs are present across multiple Bacillus species but show varying degrees of sequence conservation

    • Core structural features remain conserved despite sequence divergence

    • Evidence of positive selection in regions likely involved in species-specific interactions

  • Functional adaptation:

    • Species-specific variations in YfjF correlate with ecological niches

    • Co-evolution with immunity proteins suggests roles in inter-strain competition

    • Conservation patterns align with T7SS compatibility groups

  • Horizontal gene transfer considerations:

    • The yfj operon shows evidence of horizontal acquisition in some lineages

    • Genomic context varies, suggesting integration into different regulatory networks

    • May represent a modular component of bacterial defense systems

  • Evolutionary pressure analysis:

    • Calculation of dN/dS ratios reveals domains under purifying vs. diversifying selection

    • Interface regions with secretion machinery components show highest conservation

    • Putative effector domains display greatest sequence diversity

  • Methodological approaches to evolutionary studies:

    • Comparative genomics across Bacillus species isolates

    • Ancestral sequence reconstruction and functional testing

    • Experimental evolution under different selective pressures

    • Population genomics in natural biofilm communities

This evolutionary perspective provides crucial context for understanding YfjF function and can guide the design of experiments to test hypotheses about its role in bacterial competition, cooperation, and adaptation to diverse environments .

What emerging technologies could advance our understanding of YfjF regulation in single cells within biofilms?

Several cutting-edge technologies hold promise for elucidating YfjF regulation at the single-cell level within complex biofilm structures:

  • Spatially resolved transcriptomics:

    • Technologies like Slide-seq or Visium spatial transcriptomics adapted for bacterial biofilms

    • Correlation of yfj expression with spatial position and microenvironmental gradients

    • Integration with metabolomic data to link nutrient availability to expression patterns

  • Live-cell biosensors:

    • FRET-based sensors for key regulatory molecules (c-di-GMP, DegU~P)

    • Simultaneous visualization of multiple regulatory events using orthogonal fluorophores

    • Microfluidic devices for precise control of environmental conditions during imaging

  • CRISPRi for dynamic perturbation:

    • Inducible CRISPRi systems targeting different regulators in specific subpopulations

    • Multiplexed guide RNAs to systematically map the regulatory network

    • Integration with live-cell imaging for real-time assessment of effects

  • Single-cell multi-omics:

    • Combined transcriptomic and proteomic profiling from individual cells

    • Correlation of yfj operon mRNA levels with protein abundance

    • Identification of post-transcriptional regulatory mechanisms

  • Advanced microscopy approaches:

    • Lattice light-sheet microscopy for reduced phototoxicity during long-term imaging

    • Super-resolution techniques to visualize nanoscale organization of regulatory complexes

    • Correlative light and electron microscopy to link protein localization with ultrastructure

These technologies, especially when applied in combination, have the potential to resolve the dynamic and heterogeneous nature of YfjF regulation within biofilms, providing unprecedented insights into how individual cells coordinate their behavior within these complex communities .

How might YfjF be leveraged as a tool for synthetic biology applications in B. subtilis?

Based on current understanding of YfjF properties, several innovative synthetic biology applications can be envisioned:

  • Engineered biofilm architecture:

    • Controlled expression of YfjF to modulate cell-cell interactions within biofilms

    • Creation of structured communities with defined spatial organization

    • Programming morphogenesis through regulated cell competition

  • Controllable protein secretion systems:

    • Engineering YfjF and the T7SS as a novel protein delivery platform

    • Creating chimeric proteins where YfjF domains direct specific targeting

    • Developing inducible systems for spatiotemporally controlled protein release

  • Biosensing applications:

    • Creating reporter systems where YfjF expression responds to specific environmental signals

    • Developing competitive fitness assays based on YfjF-mediated interactions

    • Engineering biofilms with distributed sensing and response capabilities

  • Methodological approach to synthetic applications:

    • Characterization of minimal functional domains within YfjF

    • Development of standardized expression modules with predictable behavior

    • Creation of genetic circuit designs incorporating YfjF regulatory elements

    • Experimental testing in controlled microenvironments

  • Potential applications in biotechnology:

    • Enhanced protein production through controlled cell populations

    • Bioremediation applications using engineered biofilms

    • Development of stable multi-strain consortia with defined interactions

These applications would require careful optimization and characterization of YfjF behavior under different conditions, but the protein's natural role in mediating cell-cell interactions within biofilms makes it a promising candidate for synthetic biology tools focused on population-level behaviors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.