Recombinant Bacillus subtilis UPF0126 membrane protein yvgT (yvgT)

Shipped with Ice Packs
In Stock

Description

Functional Role in Membrane Protein Biogenesis

YvgT, along with SpoIIIJ, belongs to the Oxa1p/YidC protein family, which mediates membrane protein insertion and ATP synthase assembly . Key roles include:

  • Complementing YidC function: YvgT restores membrane insertion defects in E. coli lacking YidC, facilitating SecYEG-dependent and -independent integration of cytochrome o oxidase and F1Fo ATP synthase subunits .

  • ATP synthase interaction: Co-purification studies show YvgT associates with the entire B. subtilis F1Fo ATP synthase complex, suggesting a late-stage role in its assembly .

3.1. In Vitro Insertion Assays

  • YvgT mediates insertion of F1Fo ATP synthase subunit c (Foc) from both B. subtilis and E. coli into membrane vesicles .

  • Functional overlap with SpoIIIJ allows mutual substitution in B. subtilis, though SpoIIIJ is essential for sporulation .

3.2. Genetic and Biochemical Studies

  • Complementation: Expression of yvgT rescues growth defects in YidC-depleted E. coli, confirming functional conservation across bacterial species .

  • Complex association: Affinity purification and blue native PAGE (BN-PAGE) reveal YvgT forms a stable 550 kDa complex with F1Fo ATP synthase subunits (F1α, F1β, Foc) .

Interaction Network

YvgT interacts with:

Interacting PartnerFunctionExperimental Evidence
F1Fo ATP synthase subunitsEnergy transductionCo-purification, BN-PAGE
SpoIIIJMembrane protein insertionGenetic complementation
YqgA (hypothetical protein)Unknown; Bacillus-specificAffinity purification

Applications in Research

  • Membrane protein dynamics: Used to study Sec-independent insertion mechanisms .

  • ATP synthase assembly: Serves as a model for dissecting late-stage complex assembly in Gram-positive bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
yvgT; BSU33460; UPF0126 membrane protein YvgT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvgT
Target Protein Sequence
MAWELLSVIGIIAFAVSGAIVAMEEEYDILGVYILGIVTAFGGGAIRNLLIGVPVSALWE QGAYFQIALLSITIVFLFPKLLLKHWNKWGNLSDAIGLAAFAIQGALYAVKMGHPLSAVI VAAVLTGSGGGIIRDLLAGRKPLVLKAEIYAVWAALGGLIVGLGWLGNSFGLYVLFFVLV VCRVCSYMFNWKLPNRSFRLDN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0126 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant YvgT production?

Multiple expression systems have been validated for YvgT production, with E. coli being the most documented system in the literature. The comparative effectiveness of different expression systems is summarized in the following table:

Expression SystemAdvantagesChallengesRecommended For
E. coliHigh yield, established protocolsPotential improper foldingInitial characterization, antibody production
YeastBetter for complex proteins, eukaryotic PTMsLower yield than E. coliFunctional studies
MammalianNative-like folding, complex PTMsResource intensive, lower yieldInteraction studies
Insect cellsBalance between yield and proper foldingMore complex than bacterial systemsStructural studies

E. coli remains the preferred system for initial studies due to its simplicity and yield . For researchers experiencing issues with protein folding or activity, alternative eukaryotic systems may be worth exploring despite their higher complexity.

What are the optimal storage and reconstitution conditions for purified YvgT protein?

For maximum stability and retention of biological activity, the following conditions are recommended:

Storage protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

Reconstitution methodology:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Store reconstituted aliquots at -20°C/-80°C

The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) has been optimized to maintain protein stability during freeze-thaw cycles . Researchers should monitor protein stability through activity assays or structural analysis methods after extended storage periods.

How can researchers optimize purification strategies for recombinant YvgT?

Purification of membrane proteins like YvgT requires specialized approaches due to their hydrophobic nature. A successful purification workflow typically involves:

  • Membrane isolation: Differential centrifugation to separate membrane fractions from cellular debris

  • Solubilization: Selection of appropriate detergents (e.g., DDM, LDAO, or CHAPS) at concentrations above their critical micelle concentration

  • Affinity chromatography: Utilizing the His-tag for IMAC purification with careful optimization of imidazole concentrations

  • Size exclusion chromatography: To remove aggregates and achieve >90% purity as verified by SDS-PAGE

Researchers should consider implementing a systematic detergent screening approach, testing various detergent types and concentrations for optimal solubilization while maintaining protein functionality. The balance between extraction efficiency and preservation of native structure is critical.

What analytical methods are suitable for validating the structural integrity of purified YvgT?

Multiple complementary analytical techniques should be employed to confirm proper folding and structural integrity:

Analytical MethodInformation ProvidedSample Requirements
Circular Dichroism (CD)Secondary structure composition0.1-0.5 mg/mL in detergent
Size Exclusion Chromatography (SEC)Oligomeric state, aggregation0.5-1 mg in detergent solution
Thermostability assays (DSF/CPM)Protein stability, ligand binding50-100 μg with fluorescent dye
Limited proteolysisDomain identification, folding50-200 μg with various proteases
Mass spectrometryVerification of sequence integrity10-50 μg, preferably tag-free

For membrane proteins like YvgT, assessing functionality through binding assays or reconstitution into liposomes provides additional confidence in proper folding beyond structural characterization alone.

How does the choice of fusion tag impact YvgT expression and purification outcomes?

The fusion tag selection significantly influences expression yield, solubility, and downstream applications. Comparative analysis reveals:

Tag TypeImpact on ExpressionPurification MethodTag Removal Considerations
His-tagMinimal impact on folding, standard yieldIMAC (Ni-NTA, Co-TALON)TEV/3C protease cleavage
MBPEnhanced solubility, improved foldingAmylose resinPotential aggregation after cleavage
GSTImproved solubility, moderate yieldGlutathione resinDimerization may affect function
SUMOEnhanced expression, solubilityIMAC, requires His-tagClean cleavage with SUMO protease

The His-tag appears to be the most commonly used for YvgT expression , likely due to its minimal interference with protein structure and function. For challenging expression cases, larger solubility-enhancing tags like MBP may be beneficial despite the increased size and potential interference with function.

What cellular stress responses are activated during YvgT overexpression, and how can they be mitigated?

Overexpression of membrane proteins like YvgT frequently triggers stress responses that can limit yield and quality. Research indicates:

Membrane protein overproduction in Bacillus subtilis activates cell envelope stress responsive systems even when apparently no membrane protein is being produced . This suggests that the mere presence of the encoding mRNA or initial translation products can trigger stress responses.

Key stress responses and mitigation strategies:

  • Cell envelope stress response:

    • Triggered by: Membrane protein accumulation, altered membrane composition

    • Monitored by: Upregulation of σW, σM, σX regulons

    • Mitigation: Co-expression of molecular chaperones, reduced induction temperature

  • Secretion stress:

    • Triggered by: Protein misfolding at the membrane interface

    • Monitored by: CssRS two-component system activation

    • Mitigation: Optimized signal sequences, pulse-chase expression strategies

  • General stress response:

    • Triggered by: Resource depletion, growth rate reduction

    • Monitored by: σB regulon activation

    • Mitigation: Rich media formulations, controlled growth rates

Successful overproduction requires carefully balancing these stress responses, as manipulating one stress responsive system can lead to shifts in the activity of others that may benefit membrane protein yields .

How does regulatory intramembrane proteolysis (RIP) influence YvgT expression and function?

The integral membrane protease RasP has been shown to impact different processes within Bacillus subtilis at the protein level . For membrane proteins like YvgT, RIP can influence:

  • Protein maturation: RasP may cleave specific domains of membrane proteins during their maturation process

  • Protein turnover: Regulated degradation through RIP affects steady-state levels of membrane proteins

  • Signaling pathways: RIP activates ECF sigma factors through controlled proteolysis, influencing transcriptional responses

For researchers working with YvgT, understanding the potential processing by RasP and other membrane proteases is crucial as it may:

  • Affect the detected size/mass of the protein in experimental systems

  • Influence functional properties if regulatory domains are cleaved

  • Create challenges in structural studies if heterogeneous processing occurs

Strategies to investigate RIP include using protease inhibitors, generating protease-deficient expression strains, and performing mass spectrometry analysis to identify specific cleavage sites.

What are the most effective reconstitution methods for functional studies of YvgT?

Functional characterization of membrane proteins requires reconstitution into membrane-mimetic environments that maintain native conformations. For YvgT, consider these approaches:

Reconstitution MethodAdvantagesLimitationsBest For
Detergent micellesSimple preparation, homogeneousMay not support all functionsInitial characterization
LiposomesNative-like bilayer, controllable lipid compositionHeterogeneous orientationTransport/function studies
NanodiscsDefined size, accessible from both sidesComplex assemblyStructural studies, single-molecule experiments
Polymer-based systems (SMALPs)Native lipid environment retentionLimited stability in some conditionsMass spectrometry, cryo-EM

The choice of reconstitution method should be guided by the specific functional assay being performed. For initial characterization, detergent screening coupled with stability assays can identify conditions that maintain YvgT in a folded, functional state.

What computational approaches can predict YvgT protein-protein interactions and functional networks?

Computational analysis provides valuable insights into potential YvgT functions and interactions:

  • Sequence homology networks:

    • BLAST analysis against characterized proteins

    • Multiple sequence alignment with UPF0126 family members

    • Conservation analysis to identify functional residues

  • Structural predictions:

    • AlphaFold2/RoseTTAFold for tertiary structure prediction

    • Molecular dynamics simulations in membrane environments

    • Docking studies with potential interaction partners

  • Functional networks:

    • Co-expression analysis with other B. subtilis genes

    • Genomic context examination (operon structure, regulons)

    • Protein-protein interaction predictions based on structural motifs

These computational approaches should be validated experimentally through techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking mass spectrometry.

How can researchers address poor expression yields of recombinant YvgT?

When faced with low expression yields, a systematic troubleshooting approach is recommended:

  • Expression construct optimization:

    • Codon optimization for expression host

    • Evaluation of different promoter strengths

    • Testing of alternate signal sequences or fusion partners

  • Expression conditions screening:

    • Temperature gradient (16°C, 25°C, 30°C, 37°C)

    • Inducer concentration titration

    • Media composition variations (rich vs. minimal, supplements)

  • Host strain selection:

    • For E. coli: BL21(DE3), Rosetta-GAMI, or specialized membrane protein expression strains

    • For yeast: SMD1168, GS115, X-33

    • For insect cells: Sf9, Sf21, High Five

  • Co-expression strategies:

    • Molecular chaperones (GroEL/ES, DnaK/J)

    • Sigma factors relevant to membrane protein folding

    • Proteins that mitigate toxic effects

The optimal expression conditions will likely be a combination of these factors, necessitating a matrix-based experimental design to identify the ideal parameters.

What strategies can mitigate aggregation during YvgT purification?

Membrane protein aggregation during purification represents a significant challenge. Implementation of these strategies can improve outcomes:

  • Solubilization optimization:

    • Systematic screening of detergent types and concentrations

    • Addition of stabilizing agents (glycerol, specific lipids, cholesterol)

    • Testing of mixed detergent systems

  • Buffer composition:

    • pH screening (typically 7.0-8.5 for membrane proteins)

    • Salt concentration optimization (typically 150-500 mM)

    • Addition of osmolytes (trehalose, sucrose, betaine)

  • Purification workflow adjustments:

    • Maintenance of protein at concentrations below aggregation threshold

    • Addition of detergent at 2-5× CMC throughout all purification steps

    • Implementation of size exclusion chromatography as a final polishing step

  • Thermal stability enhancements:

    • Ligand addition if known binding partners exist

    • Screening for stabilizing buffer additives using thermal shift assays

    • Reduced temperature during purification steps

Monitoring aggregation through dynamic light scattering or analytical size exclusion chromatography provides quantitative feedback on the effectiveness of these interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.