Recombinant Bacillus subtilis UPF0295 protein ygzB (ygzB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ygzB; BSU08740; UPF0295 protein YgzB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ygzB
Target Protein Sequence
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWI GMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for producing Recombinant Bacillus subtilis UPF0295 protein ygzB?

The production of Recombinant Bacillus subtilis UPF0295 protein ygzB can be achieved through various expression systems, each with distinct advantages. Based on current research methodologies:

  • E. coli expression system: Most commonly used due to rapid growth and high yields, typically achieving 85% purity as determined by SDS-PAGE

  • Cell-free expression system: Particularly effective for UPF0295 protein ygzB when protein folding presents challenges

  • Yeast or mammalian expression systems: Utilized when post-translational modifications are critical

For optimal results, selection criteria should include:

  • Required protein yield

  • Post-translational modification needs

  • Downstream application purity requirements

  • Available laboratory resources

A comparative analysis of expression yields across different systems shows:

Expression SystemAverage Yield (mg/L)Purity (%)Processing TimePost-translational Modifications
E. coli10-50≥852-3 daysLimited
Cell-free0.5-5≥85HoursLimited
Yeast5-20≥854-7 daysYes
Mammalian1-10≥857-14 daysExtensive

How can researchers verify the structural integrity of purified Recombinant Bacillus subtilis UPF0295 protein ygzB?

Verifying structural integrity is essential for downstream applications. A systematic approach includes:

Basic Verification Methods:

  • SDS-PAGE: Confirms molecular weight and initial purity assessment (target: ≥85% purity)

  • Western blotting: Verifies identity using specific antibodies

  • Mass spectrometry: Confirms exact molecular weight and potential modifications

Advanced Structural Analysis:

  • Circular dichroism (CD): Assesses secondary structure elements

  • Fourier-transform infrared spectroscopy (FTIR): Provides information about protein folding

  • Nuclear magnetic resonance (NMR) spectroscopy: Offers atomic-level structural insights

  • X-ray crystallography: Determines three-dimensional structure when crystals can be obtained

For functional verification, enzymatic activity assays should be developed based on the predicted protein function, though challenges exist as UPF0295 protein ygzB is currently classified as "uncharacterized" .

What experimental design is most appropriate for studying the function of UPF0295 protein ygzB in Bacillus subtilis?

Given the uncharacterized nature of UPF0295 protein ygzB, a multi-phase experimental approach is recommended:

Phase 1: Genomic Context Analysis

  • Operon structure examination: Identify potential functional relationships with adjacent genes

  • Comparative genomics: Analyze conservation across Bacillus species (B. pumilus, B. amyloliquefaciens)

  • Protein domain prediction: Identify functional domains using bioinformatics tools

Phase 2: Gene Expression Analysis

  • RNA microarray analysis: Determine expression patterns under different conditions

  • RT-PCR: Quantify expression levels in response to environmental stimuli

Phase 3: Functional Characterization

  • Gene knockout studies: Create deletion mutants using CRISPR-Cas9 system

  • Phenotypic analysis: Compare growth curves, stress responses, and biofilm formation between wild-type and mutant strains

  • Complementation studies: Restore gene function to confirm phenotype association

A Latin square experimental design is particularly effective for this research, allowing control of multiple variables while reducing experimental units :

Condition 1Condition 2Condition 3Condition 4
Wild-typeΔygzBComplementOverexpress
ΔygzBComplementOverexpressWild-type
ComplementOverexpressWild-typeΔygzB
OverexpressWild-typeΔygzBComplement

How should researchers analyze data from expression studies of UPF0295 protein ygzB to ensure statistical validity?

Statistical analysis of ygzB expression data requires careful consideration of experimental design and data collection methodologies:

Basic Statistical Approaches:

  • Descriptive statistics: Calculate mean, median, and standard deviation for expression levels

  • Student's t-test: Compare expression between two conditions (e.g., wild-type vs. mutant)

  • ANOVA: Analyze differences across multiple experimental conditions

Advanced Statistical Considerations:

  • Statistical power calculation: Determine appropriate sample size using the formula:
    n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}
    Where n is sample size, Z values correspond to significance level and power, σ is standard deviation, and Δ is the minimum detectable difference

  • Multiple testing correction: Apply Bonferroni or False Discovery Rate adjustment when analyzing multiple genes simultaneously13

  • Normalization methods: Implement appropriate normalization for RNA expression data to account for technical variations

Analysis of variance (ANOVA) is particularly recommended for experimental designs with multiple factors:

Source of VariationSum of SquaresDegrees of FreedomMean SquareF-statisticp-value
TreatmentSSTk-1MSTMST/MSEp
BlockSSBb-1MSBMSB/MSEp
ErrorSSE(k-1)(b-1)MSE
TotalSSkb-1

Where k is the number of treatments and b is the number of blocks .

What are the practical considerations for optimizing storage conditions for Recombinant Bacillus subtilis UPF0295 protein ygzB?

Proper storage is critical for maintaining protein stability and functionality:

Standard Storage Protocol:

  • Store at -20°C for short-term storage

  • Use -80°C for extended storage periods

  • Maintain in Tris-based buffer with 50% glycerol (optimized for this protein)

  • Avoid repeated freeze-thaw cycles; prepare working aliquots for routine use

  • Store working aliquots at 4°C for up to one week

Advanced Storage Optimization:

  • Stability assessment: Conduct time-course activity measurements under different storage conditions

  • Buffer optimization: Test stability in various buffers (pH 6.5-8.0) and salt concentrations

  • Additive screening: Evaluate stabilizing agents such as reducing agents or protease inhibitors

A systematic storage stability study might generate data such as:

Storage ConditionActivity Retention (%)
Day 0Day 7Day 30Day 90
-80°C10098 ± 295 ± 392 ± 4
-20°C10095 ± 390 ± 482 ± 5
4°C10085 ± 465 ± 630 ± 8
25°C10070 ± 540 ± 715 ± 6

How can researchers effectively design experiments to study potential interactions between UPF0295 protein ygzB and other cellular components?

Studying protein-protein or protein-nucleic acid interactions requires careful experimental design:

Basic Interaction Studies:

  • Co-immunoprecipitation (Co-IP): Identifies protein binding partners in cellular context

  • Pull-down assays: Uses purified recombinant protein as bait to capture interaction partners

  • Bacterial two-hybrid system: Screens for potential protein interactions in vivo

Advanced Interaction Analysis:

  • Surface plasmon resonance (SPR): Measures binding kinetics and affinity constants

  • Isothermal titration calorimetry (ITC): Determines thermodynamic parameters of interactions

  • Microscale thermophoresis (MST): Analyzes interactions under near-native conditions

  • Crosslinking mass spectrometry (XL-MS): Maps interaction interfaces at amino acid resolution

When analyzing binding data, consider fitting to appropriate models:

  • For 1:1 binding:
    Y=Bmax×XKd+XY = \frac{B_{max} \times X}{K_d + X}
    Where Y is the binding signal, X is the concentration, Bmax is maximum binding, and Kd is the dissociation constant

  • For cooperative binding:
    Y=Bmax×XhKdh+XhY = \frac{B_{max} \times X^h}{K_d^h + X^h}
    Where h is the Hill coefficient indicating cooperativity

What approaches can be used to study the role of UPF0295 protein ygzB in Bacillus subtilis gene expression networks?

Understanding the role of ygzB in gene regulatory networks requires integrated approaches:

Basic Gene Expression Analysis:

  • RT-PCR: Quantifies expression changes of target genes in wild-type vs. ΔygzB strains

  • Northern blotting: Detects specific RNA transcripts

  • Reporter gene assays: Measures activity of promoters potentially regulated by ygzB

Advanced Network Analysis:

  • RNA-seq: Provides genome-wide transcriptional profiling in response to ygzB manipulation

  • ChIP-seq: Identifies potential DNA binding sites if ygzB has DNA-binding properties

  • Protein-DNA interaction studies: Electrophoretic mobility shift assays (EMSA) to confirm direct interactions

A typical RNA-seq experimental design might include:

SampleGenotypeConditionBiological Replicates
1-3Wild-typeStandard3
4-6ΔygzBStandard3
7-9Wild-typeStress3
10-12ΔygzBStress3

For data analysis, differential expression analysis using tools like DESeq2 or edgeR should be employed with appropriate statistical thresholds (e.g., adjusted p-value < 0.05 and fold change > 2)13.

What methodologies are most effective for studying the localization of UPF0295 protein ygzB within Bacillus subtilis cells?

Determining protein localization provides insights into function:

Basic Localization Methods:

  • Fluorescent protein fusion: Create C- or N-terminal GFP fusions to visualize localization

  • Immunofluorescence: Use specific antibodies to detect native protein localization

  • Subcellular fractionation: Physically separate cellular components followed by Western blotting

Advanced Localization Techniques:

  • Super-resolution microscopy: Achieves nanometer-scale resolution of protein localization

  • Single-molecule tracking: Monitors dynamics of individual protein molecules in living cells

  • Correlative light and electron microscopy (CLEM): Combines fluorescence with ultrastructural context

  • Proximity labeling methods: BioID or APEX2 fusion to identify neighboring proteins

For fluorescent protein fusion experiments, consider:

  • Create both N- and C-terminal fusions to account for potential interference with localization signals

  • Include appropriate controls (free fluorescent protein, known localization markers)

  • Validate functionality of fusion protein through complementation studies

  • Use time-lapse imaging to capture dynamic localization changes during cell cycle or stress response

How can researchers investigate the evolutionary conservation and significance of UPF0295 protein ygzB across bacterial species?

Evolutionary analysis provides context for functional studies:

Basic Evolutionary Analysis:

  • Sequence alignment: Compare ygzB homologs across bacterial species

  • Phylogenetic tree construction: Establish evolutionary relationships

  • Conservation analysis: Identify highly conserved residues that may be functionally important

Advanced Evolutionary Approaches:

  • Synteny analysis: Examine conservation of genomic context

  • Selection pressure analysis: Calculate dN/dS ratios to identify sites under positive or purifying selection

  • Ancestral sequence reconstruction: Infer evolutionary trajectory of the protein

  • Structure-guided evolutionary analysis: Map conservation onto predicted structural models

A typical workflow includes:

  • Identify homologs using BLAST searches against diverse bacterial genomes

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Generate phylogenetic trees using maximum likelihood methods

  • Calculate conservation scores for each position

  • Correlate conservation with predicted functional domains or structural elements

This approach can reveal whether UPF0295 domain is maintained across Bacillus species (B. pumilus, B. amyloliquefaciens, B. subtilis) and related genera .

What are the most significant challenges in characterizing uncharacterized proteins like UPF0295 protein ygzB, and how can researchers overcome them?

Characterizing proteins of unknown function presents unique challenges:

Common Challenges:

  • Lack of known functional domains: UPF0295 designation indicates unknown function

  • Absence of phenotypic changes in deletion mutants: Functional redundancy may mask effects

  • Limited structural information: No crystal structures available for UPF0295 family proteins

  • Difficulty in establishing biochemical assays without functional predictions

Methodological Solutions:

  • Integrated omics approach: Combine transcriptomics, proteomics, and metabolomics data

  • Condition screening: Test mutant phenotypes under diverse environmental conditions

  • Synthetic lethality screening: Identify genetic interactions through double mutant analysis

  • Structure prediction: Utilize AlphaFold2 or similar tools to predict protein structure

  • Protein interaction networks: Map the interactome to infer function through guilty-by-association

A systematic workflow for characterizing uncharacterized proteins:

  • Bioinformatic analysis (sequence similarity, structural prediction, genomic context)

  • Expression analysis (conditions affecting expression levels)

  • Phenotypic screening (growth, stress response, specialized metabolites)

  • Protein interaction studies (identification of binding partners)

  • Biochemical characterization (purification, activity testing against substrate panels)

  • Structural studies (crystallography, cryo-EM, or NMR)

This integrated approach maximizes the likelihood of functional assignment while managing research resources efficiently.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.