Recombinant Bacillus subtilis UPF0344 protein yisL (yisL)

Shipped with Ice Packs
In Stock

Description

Basic Molecular Properties

The UPF0344 protein yisL is classified as a putative integral membrane protein in Bacillus subtilis. It consists of 118 amino acids forming a transmembrane structure with specific hydrophobic regions that facilitate its integration into the bacterial cell membrane . The protein has been assigned the UniProt accession number O06725, allowing researchers to access standardized information about its molecular characteristics .

The molecular structure of yisL features multiple transmembrane domains that anchor it within the bacterial cell membrane. These domains create a distinctive topology that likely relates to the protein's functional role within the cell. The transmembrane nature of this protein suggests its involvement in processes that occur at the interface between the cytoplasm and the external environment, potentially including signaling, transport, or structural functions.

Predicted Functions

The exact function of the UPF0344 protein yisL remains partially characterized, with evidence primarily derived from structural features, conserved amino acid motifs, and limited homology to better-studied proteins . Based on these analyses, yisL is classified as a putative membrane component with potential roles in cellular processes that involve the bacterial membrane.

While direct experimental evidence for the specific cellular role of yisL is limited, its classification within the UPF0344 family provides some clues about its potential functions. Proteins in this family often participate in basic cellular processes, though many remain functionally uncharacterized across different bacterial species.

Protein Interaction Network

Protein interaction network analysis through the STRING database reveals significant associations between yisL and several other B. subtilis proteins, suggesting its involvement in specific cellular pathways . These interactions provide valuable context for understanding the functional role of yisL within the bacterial cell.

Interacting ProteinFunctionInteraction Confidence Score
bshBBMalate N-acetylglucosamine deacetylase involved in bacillithiol biosynthesis0.874
kbaAInner membrane protein involved in activation of KinB signaling pathway to sporulation0.758
bstBacillithiol S-transferase0.756
yisPPutative squalene/phytoene synthase0.750

The strongest interaction (confidence score 0.874) is observed with bshBB, an enzyme involved in the biosynthesis of bacillithiol, a low-molecular-weight thiol important for maintaining redox homeostasis in B. subtilis . This association suggests yisL may participate in oxidative stress responses or related protective mechanisms in the bacterial cell.

The interaction with kbaA (confidence score 0.758) suggests a potential role in sporulation signaling pathways, while the association with bst (0.756) further supports connections to bacillithiol-related processes . The interaction with yisP (0.750) is particularly interesting, as yisP has been implicated in biofilm formation and lipid membrane structure modification in B. subtilis .

Expression Systems and Tags

Recombinant yisL protein is typically produced using Escherichia coli expression systems, which allow for controlled and efficient production of the bacterial protein . The recombinant form is commonly produced with an N-terminal histidine tag (His-tag), typically containing 10 histidine residues (10xHis-tag), which facilitates purification through metal affinity chromatography .

Research indicates that tag selection can significantly impact protein expression levels in B. subtilis. Studies with other proteins have shown that the combination of an N-terminal domain of B. subtilis lysyl tRNA synthetase (LysSN) with His-tags can enhance expression levels of low-expression genes by up to 23.5 times compared to untagged proteins . While not specifically tested with yisL, these findings suggest potential strategies for optimizing yisL expression in recombinant systems.

Genetic Organization in B. subtilis

The yisL gene is identified by the ordered locus name BSU10760 in the B. subtilis genome . The genomic context of yisL provides insights into its potential functional relationships with neighboring genes and its evolutionary history within the Bacillus genus.

The placement of yisL in proximity to yisP (BSU10760) on the B. subtilis chromosome is particularly noteworthy given their demonstrated protein-protein interaction . YisP has been characterized as involved in biofilm formation in B. subtilis and functions as a phosphatase that catalyzes the formation of farnesol from farnesyl diphosphate . This proximity and interaction suggest a potential functional relationship between these proteins in membrane-related processes.

Evolutionary Conservation

As a member of the UPF0344 protein family, yisL shares structural and sequence features with homologous proteins across various bacterial species. The conservation pattern of this protein family suggests functional importance, despite limited characterization of their specific roles.

The UPF0344 designation (Uncharacterized Protein Family 0344) indicates that while these proteins share recognizable sequence and structural features, their precise biological functions remain to be fully elucidated. This classification serves as an important placeholder in protein databases until more detailed functional characterization becomes available.

Functional Genomics Approaches

The limited functional characterization of yisL presents opportunities for comprehensive functional genomics studies. Techniques such as gene knockout or knockdown, coupled with phenotypic analysis, could reveal the consequences of yisL deficiency in B. subtilis. Similarly, overexpression studies might identify gain-of-function phenotypes that provide clues to the protein's normal role.

The protein's interactions with components of bacillithiol biosynthesis and sporulation pathways suggest potential involvement in stress response and developmental processes . Targeted studies of these pathways in the context of yisL manipulation could yield valuable insights into these essential bacterial processes.

Biotechnological Applications

The transmembrane nature of yisL and its potential involvement in membrane-associated processes make it an interesting candidate for biotechnological applications. If further characterized, yisL could potentially be utilized in:

  • Development of biosensors for environmental monitoring

  • Engineering of bacterial strains with enhanced membrane properties

  • Creation of novel protein expression systems leveraging membrane protein trafficking

These applications would require deeper understanding of yisL function but represent promising directions for applied research building on fundamental characterization of this protein.

Purification Challenges

As a transmembrane protein, yisL presents specific challenges for purification and characterization. Membrane proteins typically require specialized detergent-based extraction methods to maintain their native conformation and functionality when removed from the lipid bilayer.

The N-terminal His-tag commonly used in recombinant yisL preparations facilitates purification through immobilized metal affinity chromatography (IMAC), but optimization of buffer conditions and detergent selection remains critical for obtaining functionally intact protein . The commercial availability of purified recombinant yisL addresses these challenges for researchers requiring the protein for specific applications.

Expression Optimization

Research on protein expression in B. subtilis has shown that tag selection significantly impacts expression levels, with combinations of LysSN and His-tags demonstrating particular effectiveness for enhancing expression of low-expression genes . While these findings derive from studies with reporter genes rather than yisL specifically, they suggest potential strategies for optimizing yisL expression in recombinant systems.

The number of histidine residues in His-tags (6×His, 8×His, 10×His) has been shown to affect expression levels of low-expression genes, though this effect is not observed with high-expression genes . Commercial preparations of recombinant yisL typically utilize 10×His-tags, suggesting this configuration may offer optimal expression or purification properties .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us. We will prioritize developing your specified tag whenever possible.
Synonyms
yisL; BSU10760; UPF0344 protein YisL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yisL
Target Protein Sequence
MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0344 protein YisL and what is known about its characteristics?

YisL (designated as O06725|YISL_BACSU in protein databases) belongs to the UPF0344 protein family in Bacillus subtilis. It represents one of many uncharacterized proteins in the B. subtilis proteome . The UPF designation (Uncharacterized Protein Family) indicates that while the protein has been identified through genomic analysis, its biological function and structure remain largely undetermined.

The protein is encoded by the yisL gene in B. subtilis and is part of the extensive catalog of proteins whose functions have been predicted through computational methods but require experimental validation. Unlike many other B. subtilis proteins that have well-characterized roles in cellular processes, YisL's physiological role, interaction partners, and biochemical activities remain to be elucidated through targeted research approaches.

What expression systems are most suitable for producing recombinant YisL in B. subtilis?

For successful expression of recombinant YisL in B. subtilis, several expression systems can be employed:

  • Inducible promoter systems: IPTG-inducible or xylose-inducible systems are commonly used for controlled expression. The Pspac and Pxyl promoters offer tight regulation of expression timing .

  • Self-inducible expression systems: These eliminate the need for chemical inducers, potentially reducing production costs. Various self-inducible promoters have been developed specifically for B. subtilis that respond to growth phase or environmental conditions .

  • Constitutive promoters: For cases where continuous expression is desired, strong constitutive promoters like P43 can be utilized .

  • Secretion-based systems: If extracellular production is desired, expression systems incorporating signal peptides that direct proteins through the Sec pathway can be implemented .

Table 1: Comparison of Expression Systems for Recombinant YisL Production in B. subtilis

Expression SystemPromoterInduction MethodAdvantagesLimitations
IPTG-induciblePspacAddition of IPTGTight regulation, adjustable expression levelsCost of inducer, potential leaky expression
Xylose-induciblePxylAddition of xyloseTight regulation, less costly inducerMedium composition restrictions
Self-induciblePgroE, PaprEGrowth phase or environmental changesNo need for inducers, economical for scale-upLess precise control of expression timing
ConstitutiveP43, PvegNone (continuous)Simplicity, continuous productionCannot halt expression if toxic
SecretoryAny, with signal peptideDepends on promoterSimplified downstream processingPotential degradation by extracellular proteases

How can I verify the successful expression of recombinant YisL?

Verification of YisL expression requires multiple complementary approaches:

  • SDS-PAGE analysis: Run protein samples on polyacrylamide gels to visualize a band at the expected molecular weight of YisL. This provides initial confirmation of expression .

  • Western blotting: For more specific detection, use antibodies against YisL or against a tag (His, FLAG, etc.) if one was included in the construct. This method confirms the identity of the expressed protein .

  • Mass spectrometry: For definitive identification, tryptic digestion followed by MS/MS analysis provides peptide sequence information that can be matched to the expected YisL sequence .

  • Functional assays: Though challenging for uncharacterized proteins, attempting activity assays based on predicted functions of the UPF0344 family might provide functional verification.

It is crucial to include appropriate controls in expression verification. When using Western blot, always test for cross-contamination with other proteins, as recombinant preparations can sometimes contain unexpected contaminants that may lead to misinterpretation of results .

What growth media compositions optimize YisL expression in B. subtilis?

Medium composition significantly impacts recombinant protein expression in B. subtilis. For YisL expression, consider these optimized approaches:

  • Rich media formulations: Luria-Bertani (LB) or 2xYT media support robust growth but may lead to inconsistent expression due to undefined components .

  • Defined minimal media: Provide better reproducibility and potentially higher specific yields. A typical formulation includes glucose or glycerol as carbon source, essential salts, and trace elements specifically optimized for B. subtilis .

  • Supplemented semi-defined media: Addition of casamino acids (0.2-0.5%) to minimal media can enhance growth while maintaining good expression control.

  • Specialized media components:

    • MgSO₄ (5-10 mM) to stabilize the cell membrane

    • CaCl₂ (5-10 mM) to reduce proteolytic degradation

    • MOPS buffer (100 mM) to maintain optimal pH during growth

The optimal pH range for B. subtilis cultivation is typically 6.8-7.2, with temperature at 30-37°C depending on the expression system used. Since YisL is an uncharacterized protein, it's advisable to test expression under various conditions to determine optimal parameters.

What strategies can enhance the yield and solubility of recombinant YisL?

Maximizing yield and solubility of recombinant YisL requires a multi-faceted approach:

  • Codon optimization: Adjust the coding sequence to match B. subtilis codon usage preferences, which can significantly improve translation efficiency .

  • Fusion tags selection: For uncharacterized proteins like YisL, testing multiple fusion partners is recommended:

    • Solubility enhancers: Thioredoxin, SUMO, or MBP tags

    • Purification facilitators: His6, Strep, or FLAG tags

    • Dual-function tags: GST (both solubility and purification)

  • Expression temperature modulation: Lower temperatures (25-30°C) often enhance proper folding and solubility at the expense of growth rate .

  • Chaperone co-expression: Co-expressing molecular chaperones like GroEL/GroES can assist in proper protein folding .

  • Protease-deficient host strains: Use B. subtilis strains with knocked-out extracellular proteases (e.g., WB800 strain lacking eight proteases) to minimize degradation .

Table 2: Optimization Strategies for YisL Expression and Their Impact

StrategyImplementation MethodExpected ImpactSuccess Indicators
Codon optimizationGene synthesis with B. subtilis-preferred codons1.5-3× increase in expressionHigher protein yield without changing other parameters
Fusion tagsN- or C-terminal tag additionEnhanced solubility and simplified purificationIncreased soluble fraction in lysates
Low-temperature expressionCultivation at 25-30°C post-inductionImproved folding, reduced inclusion bodiesHigher ratio of soluble to insoluble protein
Chaperone co-expressionCo-transformation with chaperone plasmidsAssisted folding of difficult proteinsIncreased yield of correctly folded protein
Protease engineeringUse of protease-deficient strainsReduced degradationIntact protein band on SDS-PAGE, less degradation products

What purification strategies are most effective for isolating recombinant YisL?

Purifying recombinant YisL requires selecting appropriate techniques based on the protein's characteristics and expression system:

  • Affinity chromatography: If YisL is expressed with a tag, use the corresponding affinity resin:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged YisL

    • Glutathione sepharose for GST-tagged YisL

    • Amylose resin for MBP-tagged YisL

  • Ion exchange chromatography: Based on the theoretical isoelectric point of YisL, select appropriate ion exchange resins:

    • Cation exchange (SP, CM) if YisL's pI is above the buffer pH

    • Anion exchange (Q, DEAE) if YisL's pI is below the buffer pH

  • Size exclusion chromatography: Particularly useful as a polishing step to remove aggregates and achieve high purity.

  • Tag removal considerations: If the fusion tag needs to be removed, select a protease cleavage site that leaves minimal or no additional residues on YisL after processing.

When purifying uncharacterized proteins like YisL, it's advisable to test protein stability in various buffer conditions. A thermal shift assay can quickly identify stabilizing buffer components that improve purification yield and subsequent storage stability.

How can I assess and address potential contamination issues with recombinant YisL preparations?

Contamination in recombinant protein preparations can significantly impact experimental results. For YisL, implement these rigorous quality control measures:

  • Multiple analytical methods: Combine SDS-PAGE, Western blotting, and mass spectrometry to detect contaminants .

  • Verification from multiple suppliers/batches: If using commercially produced YisL, test preparations from different suppliers to identify potential systematic contamination issues .

  • Testing for biological activity: Unexpected activities in your preparation could indicate contamination with another bioactive protein. This is particularly important for uncharacterized proteins like YisL where the expected activity is unknown .

  • Endotoxin testing: For applications sensitive to bacterial endotoxins, use LAL or recombinant Factor C assays to quantify endotoxin levels.

Table 3: Contamination Assessment Methods for Recombinant YisL

Analytical MethodDetection CapabilitySensitivityLimitations
SDS-PAGE with silver stainingProtein contaminants differing in MW~1 ng proteinPoor resolution of similar-sized proteins
Western blotSpecific proteins using antibodies~100 pg proteinRequires specific antibodies, potential cross-reactivity
Mass spectrometryProtein identification by peptide mass fingerprintingfmol-pmol rangeRequires specialized equipment, expertise
Activity assaysFunctionally active contaminantsVaries by assayMay miss inactive contaminants
Endotoxin assaysBacterial lipopolysaccharides0.01-0.1 EU/mLSpecific only for endotoxins, not other contaminants

What approaches can characterize the function of uncharacterized proteins like YisL?

Elucidating the function of uncharacterized proteins like YisL requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology comparisons with characterized proteins

    • Structural prediction using tools like AlphaFold

    • Domain identification to predict potential functions

    • Genomic context analysis to identify functional associations

  • Gene knockout studies: Generate and phenotype B. subtilis strains lacking the yisL gene to observe changes in growth, metabolism, or stress responses .

  • Protein-protein interaction studies:

    • Pull-down assays using tagged YisL to identify binding partners

    • Bacterial two-hybrid screening

    • Cross-linking followed by mass spectrometry (XL-MS)

  • Transcriptomic and proteomic analysis: Compare wild-type and yisL-overexpressing or knockout strains to identify affected pathways .

  • Experimental evolution: Subject B. subtilis to specific selective pressures and analyze if and how the yisL gene evolves, potentially revealing its function in adaptative responses .

  • Heterologous expression: Express YisL in other bacterial species where the UPF0344 family is absent, then analyze phenotypic changes.

  • Structural studies: Determine the three-dimensional structure using X-ray crystallography or cryo-EM to gain insights into potential functions based on structural features.

How can B. subtilis secretion systems be optimized for extracellular production of YisL?

For extracellular production of YisL, optimizing secretion pathways in B. subtilis offers several advantages including simplified purification and potential for continuous production:

  • Signal peptide selection: Test multiple signal peptides to identify the most efficient for YisL secretion:

    • AmyE (α-amylase) signal peptide - often efficient for heterologous proteins

    • AprE (subtilisin) signal peptide - high secretion efficiency

    • LipA (lipase) signal peptide - useful for some recalcitrant proteins

  • Secretion pathway engineering:

    • Overexpress components of the Sec machinery to enhance translocation capacity

    • Co-express secretion-specific chaperones like PrsA to assist folding of secreted proteins

    • Modify cell wall properties to facilitate protein release

  • Protease mitigation strategies:

    • Use multiple protease-deficient strains (e.g., WB800)

    • Add protease inhibitors to the culture medium

    • Engineer the protein sequence to eliminate protease recognition sites

  • Two-component secretion systems: For difficult-to-secrete proteins, heterologous secretion systems like the Type I secretion system components (similar to HlyA system from E. coli) can be adapted for B. subtilis .

  • Medium optimization for secretion: Adjust calcium and magnesium levels, which can affect membrane permeability and protein secretion efficiency.

Table 4: Comparison of Secretion Strategies for YisL in B. subtilis

Secretion StrategyMechanismAdvantagesLimitationsReported Efficiencies
Sec pathway with AmyE signalCo-translational secretionWell-characterized, high capacitySize limitations, folding issuesUp to 3 g/L for some proteins
Sec pathway with AprE signalCo-translational secretionNatural high-secretion signalPotential signal peptidase bottlenecks1-5 g/L possible
PrsA co-expressionPost-translocational folding assistanceImproves folding of secreted proteinsAdditional metabolic burden1.5-3× improvement
WB800 strain (8 proteases deleted)Reduced extracellular proteolysisSignificantly enhanced stabilityGrowth defects possibleProtein-dependent
Leaky phenotype engineeringMembrane permeabilizationSimplified secretion mechanismCell stress, potential lysisVariable, up to 90% secretion

How do I design experiments to identify potential binding partners and substrates for YisL?

Identifying interaction partners for an uncharacterized protein like YisL requires systematic approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged YisL in B. subtilis

    • Perform pull-down experiments under various conditions (different growth phases, stress conditions)

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Bacterial two-hybrid screening:

    • Create a library of B. subtilis proteins as prey

    • Use YisL as bait to identify interactions

    • Confirm positive interactions with orthogonal methods

  • Crosslinking approaches:

    • In vivo crosslinking in B. subtilis expressing YisL

    • Identify crosslinked partners by mass spectrometry

    • Map interaction interfaces using MS/MS fragmentation data

  • Metabolite screening:

    • If YisL is predicted to be an enzyme, test activity against libraries of potential substrates

    • Monitor substrate consumption or product formation using LC-MS

    • Validate enzymatic activity with purified components

  • Comparative genomics:

    • Analyze genes consistently co-occurring with yisL across bacterial species

    • Identify conserved genomic neighborhoods that suggest functional relationships

    • Test predicted functional associations experimentally

The combination of these approaches increases the likelihood of identifying biologically relevant interactions for YisL and placing it in a functional context within B. subtilis biology.

How can I resolve experimental contradictions in YisL functional studies?

When faced with contradictory results in YisL characterization, implement a systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein identity by mass spectrometry

    • Check for batch-to-batch variation in preparations

    • Assess protein stability and aggregation state before experiments

    • Test for contamination with other bioactive proteins

  • Experimental conditions evaluation:

    • Systematically vary buffer conditions, pH, salt concentration

    • Test addition of potential cofactors or activators

    • Consider post-translational modifications that might be missing

  • Controls and validation:

    • Include positive and negative controls in all assays

    • Use multiple orthogonal methods to test the same hypothesis

    • Validate findings with both in vitro and in vivo approaches

  • Literature discrepancy analysis:

    • Create a comprehensive comparison table of contradictory results

    • Identify methodological differences that might explain discrepancies

    • Contact authors of conflicting studies for clarification on specific protocols

When working with uncharacterized proteins like YisL, contradictions often arise from incomplete understanding of the protein's requirements for activity or differences in experimental conditions that affect its behavior.

What evolutionary approaches can reveal YisL function in B. subtilis?

Evolutionary studies offer powerful insights into protein function, particularly for uncharacterized proteins like YisL:

  • Laboratory evolution experiments:

    • Subject B. subtilis to selective pressures (temperature, nutrient limitation, etc.)

    • Sequence evolved strains to identify mutations in yisL

    • Characterize phenotypic changes associated with yisL mutations

  • Comparative genomics across Bacillus species:

    • Analyze conservation patterns of YisL homologs

    • Identify correlated gene presence/absence patterns

    • Map evolutionary rate to protein structure to identify functional sites

  • Gene distribution analysis:

    • Map the presence of yisL homologs across bacterial phylogeny

    • Correlate presence with specific ecological niches or metabolic capabilities

    • Test hypothesized functions in heterologous systems

  • Ancestral sequence reconstruction:

    • Reconstruct ancestral versions of YisL

    • Compare biochemical properties of ancestral and modern proteins

    • Identify evolutionary transitions that might reveal function

B. subtilis has been shown to adapt remarkably to various environmental challenges, including low atmospheric pressure, high UV radiation, and unfavorable growth temperatures . Studying how YisL evolves under these conditions can provide insights into its potential role in stress response or adaptation mechanisms.

How can I address common challenges in recombinant YisL expression and purification?

Troubleshooting YisL expression and purification requires systematic problem-solving:

  • Low expression yields:

    • Check codon optimization for B. subtilis preference

    • Test different promoters and induction conditions

    • Evaluate mRNA stability and potential toxicity

    • Consider co-expression with chaperones

  • Insoluble protein formation:

    • Lower induction temperature (25-30°C)

    • Test different fusion tags (MBP, SUMO, Thioredoxin)

    • Add solubility enhancers to lysis buffer (glycerol, mild detergents)

    • Consider refolding from inclusion bodies if necessary

  • Proteolytic degradation:

    • Use protease inhibitor cocktails

    • Express in protease-deficient strains

    • Modify purification protocol to minimize time

    • Keep samples cold throughout processing

  • Low purity after purification:

    • Implement multi-step purification strategy

    • Optimize washing conditions for affinity chromatography

    • Add polishing steps like ion exchange or size exclusion

    • Consider on-column refolding for difficult proteins

  • Protein instability during storage:

    • Screen buffer conditions using thermal shift assays

    • Test stabilizing additives (glycerol, arginine, trehalose)

    • Optimize flash-freezing protocols

    • Consider lyophilization for long-term storage

Table 5: Troubleshooting Guide for Common YisL Expression Issues

IssuePotential CausesTroubleshooting StrategiesSuccess Indicators
Low expressionPoor transcription, inefficient translation, toxicityPromoter optimization, codon optimization, induction condition screeningVisible band on SDS-PAGE, increased yield measurement
InsolubilityMisfolding, hydrophobic patches, aggregationLower temperature, solubility tags, buffer optimizationIncreased protein in soluble fraction after centrifugation
DegradationHost proteases, autoproteolysis, instabilityProtease inhibitors, protease-deficient strains, expedited purificationIntact band on SDS-PAGE, reduced degradation products
Purification difficultiesNon-specific binding, aggregation, poor tag accessibilityBuffer optimization, sequential chromatography, tag position changesIncreased purity on SDS-PAGE, improved chromatography profiles
Loss during storageBuffer incompatibility, freeze-thaw damage, oxidationStabilizing additives, flash-freezing, aliquoting samplesRetained activity after storage, reduced precipitation

What methods can detect and prevent experimental artifacts when studying YisL?

When investigating an uncharacterized protein like YisL, distinguishing true biological results from artifacts requires rigorous controls:

  • Protein quality checks:

    • Implement routine mass spectrometry analysis to confirm protein identity

    • Use multiple protein production methods to validate consistent results

    • Test for contaminating activities that might confound results

  • Technical controls:

    • Include tag-only controls for tagged YisL experiments

    • Use unrelated proteins of similar size/structure as specificity controls

    • Perform mock purifications from cells lacking YisL expression

  • Biological validation:

    • Confirm in vitro findings with in vivo experiments

    • Use knockout and complementation studies to validate functions

    • Test activity in heterologous systems

  • Assay validation:

    • Establish dose-dependency for all observed effects

    • Implement positive and negative controls for all assays

    • Test for interference from buffer components or contaminants

What emerging technologies might accelerate functional characterization of YisL and similar proteins?

Several cutting-edge technologies show promise for unraveling the functions of uncharacterized proteins like YisL:

  • AlphaFold and structural prediction:

    • Generate high-confidence structural models without crystallization

    • Predict functional sites based on structural features

    • Guide rational experimental design for functional testing

  • CRISPR-based techniques:

    • CRISPRi for tunable repression to study dosage effects

    • CRISPR interference screening to identify genetic interactions

    • CRISPR-based roadblocking to study transcriptional contexts

  • Single-cell techniques:

    • Single-cell RNA-seq to identify cell-to-cell variability in yisL expression

    • Time-lapse microscopy with fluorescent reporters to track dynamic processes

    • Microfluidics for precise environmental control during observations

  • Protein painting and limited proteolysis coupled to mass spectrometry:

    • Map protein interaction surfaces with high resolution

    • Identify dynamic regions that might be involved in substrate binding

    • Detect conformational changes upon ligand binding

  • Metabolomics approaches:

    • Compare metabolite profiles between wild-type and yisL knockout strains

    • Identify metabolic pathways affected by YisL presence/absence

    • Use stable isotope labeling to track metabolic fluxes

These technologies, combined with traditional approaches, create powerful platforms for deciphering the functions of the many uncharacterized proteins that remain in bacterial genomes, including B. subtilis YisL.

How can systematic interactome studies help position YisL in cellular pathways?

Mapping the interaction network of YisL can provide crucial insights into its cellular function:

  • Comprehensive interactome mapping:

    • Perform systematic binary interaction tests (Y2H or BACTH)

    • Implement BioID or APEX proximity labeling in B. subtilis

    • Use quantitative AP-MS under various conditions

  • Network analysis approaches:

    • Identify network clusters containing YisL

    • Map YisL to known cellular pathways based on interaction partners

    • Predict function based on "guilt by association" principles

  • Temporal interaction dynamics:

    • Study how YisL interactions change during growth phases

    • Examine interaction changes under stress conditions

    • Track interaction dynamics during B. subtilis sporulation

  • Structural interactomics:

    • Map interaction interfaces using hydrogen-deuterium exchange MS

    • Model protein-protein complexes using integrative structural biology

    • Validate interaction models with targeted mutagenesis

Understanding how YisL connects to other cellular components will help place this uncharacterized protein into a functional context and generate testable hypotheses about its role in B. subtilis physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.