Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
floA; yqfA; BSU25380; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqfA
Target Protein Sequence
MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFTLVGMRLRRVIPNRVV
NPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIELTFERCAAIDLAGRDV
LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERLVGGAGEETIVARVGEGI
VSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA
EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD
YMNIKNIDADTEMRDSFGKLTKDPSDEDRKS
Uniprot No.
Target Background
Function
Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. FloA and FloT functions demonstrate partial redundancy; their double deletion results in significant synthetic phenotypes. Flotillins are believed to play a crucial role in membrane fluidity, particularly during periods of rapid growth in nutrient-rich media. The association of specific proteins with FMMs remains a subject of debate. One study linked FloT rafts to proteins involved in stationary-phase adaptation, while FloA-FloT rafts were associated with proteins involved in differentiation processes, including sporulation, biofilm formation, and DNA uptake competence. A more refined study, however, only identified an association between NfeD2 and FloT rafts among the proteins examined. yqfA is involved in membrane spatial organization, potentially recruiting proteins to specific membrane regions. Simultaneous overexpression of FloA and FloT leads to cell division and differentiation defects, partly due to FtsH stabilization and its enhanced protein degradation activity. This results in increased biofilm production, shorter cell lengths, reduced EzrA levels, and more frequent Z-rings.
Database Links
KEGG: bsu:BSU25380
STRING: 224308.Bsubs1_010100013881
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
