Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS)
Shipped with Ice Packs 
In Stock 
Description
Research Context and Applications
While specific studies on ydaS are absent in the provided literature, B. subtilis is a well-established platform for heterologous protein production. General insights into B. subtilis protein secretion systems may inform potential applications:
-
Secretion Pathways:
-
Protease Resistance:
B. subtilis strains with reduced proteolytic activity (e.g., WB800N) are commonly used to minimize degradation during secretion . -
Surface Display:
Strategies like fusion with signal peptides or adhesion proteins (e.g., L-Lectin-β-GF) enhance mucosal targeting, as demonstrated in vaccine delivery systems .
Data Gaps and Potential Research Directions
The ydaS protein remains uncharacterized in functional studies. Future research could explore:
| Area | Potential Focus |
|---|---|
| Functional Annotation | Bioinformatics prediction of enzymatic activity or interaction partners |
| Structural Analysis | X-ray crystallography or NMR to resolve 3D conformation |
| Biotechnological Utility | Testing in enzyme cascades or biofilm engineering |
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as best as possible.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ydaS; BSU04370; UPF0410 protein YdaS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-85
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydaS
Target Protein Sequence
MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAI
FPAIIGAAIFVFLLGLIFRGLRKEA
Uniprot No.
Target Background
Database Links
KEGG: bsu:BSU04370
STRING: 224308.Bsubs1_010100002478
Protein Families
UPF0410 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
