Recombinant Bacillus subtilis UPF0699 transmembrane protein ydbS (ydbS)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus subtilis UPF0699 transmembrane protein ydbS (ydbS) is a protein that belongs to the UPF0699 (Unknown Protein Function) family and is found in Bacillus subtilis . It is a transmembrane protein, meaning it is located in the cell membrane . The ydbS protein is encoded by the ydbS gene, also known as BSU04590 .

Characteristics

ydbS is a full-length protein consisting of 159 amino acids . The recombinant form of this protein is often produced in E. coli and may include a His-tag for purification purposes . The molecular weight of the protein is around 17.4 kDa .

Table 1: Characteristics of Recombinant ydbS Protein

CharacteristicDescription
SpeciesBacillus subtilis (strain 168)
Protein LengthFull Length (1-159 amino acids)
Molecular Weight~17.4 kDa
TagHis-tag (N-terminal)
SourceE. coli
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol
UniProt IDP96615
Gene NameydbS
Ordered Locus NamesBSU04590

Function and Role

The precise function of ydbS in Bacillus subtilis is not yet clearly defined, as it belongs to the UPF0699 family of proteins with unknown function . UPF0699 proteins are conserved across various bacterial species, suggesting they may play a significant role in bacterial physiology . Research indicates that Bacillus subtilis has mechanisms to manage membrane protein biogenesis, where proteins like SpoIIIJ and YqjG (Oxa1p homologs) are involved, implying ydbS might also participate in these processes .

Expression and Purification

Recombinant ydbS is typically produced in E. coli expression systems . The protein is often expressed with an N-terminal His-tag, which allows for purification using nickel affinity chromatography . Following purification, the protein is commonly stored in a Tris-based buffer with glycerol at -20°C to -80°C to maintain stability .

Role in Membrane Protein Biogenesis

Bacillus subtilis employs proteins like SpoIIIJ and YqjG for membrane protein biogenesis . These proteins are involved in the insertion and folding of proteins into the membrane . Furthermore, a ribosome-nascent chain sensor, such as MifM, can regulate the expression of YidC2 based on the activity of SpoIIIJ, indicating a complex mechanism for maintaining membrane protein homeostasis . Although direct evidence linking ydbS to these pathways is limited, its nature as a transmembrane protein suggests a potential role in membrane-associated processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ydbS; BSU04590; UPF0699 transmembrane protein YdbS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydbS
Target Protein Sequence
MREQPKNQISPDGLKVWRLQEIIISAVCLLIVIAVAVLSYYFHWPYWISGVLGAVWLLGS IVTVFIIPKVRHKVWRYEVHEHEIDIQSGIFVVTRVIVPMVRVQHVDTSQGPLLKKYNLA TVKISTAATVHSIPALEMEEADRLRDSISRLARVTDDDV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0699 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YdbS protein and where is it located in Bacillus subtilis?

YdbS is a UPF0699 family transmembrane protein found in the cell membrane of Bacillus subtilis. This protein consists of 159 amino acids with a molecular weight of 17.98 kDa and an isoelectric point (pI) of 8.13 . YdbS is encoded by the gene located at coordinates 512,814 → 513,293 in the B. subtilis genome and forms an operon with ydbT, another member of the UPF0699 protein family . The protein's primary function appears to be conferring resistance against antimicrobial compounds produced by Bacillus amyloliquefaciens, suggesting its potential role in bacterial defense mechanisms .

What expression systems are most effective for recombinant YdbS production?

For recombinant YdbS production, E. coli expression systems have demonstrated effectiveness, particularly when the protein is fused with an N-terminal His tag . The successful expression approach includes:

  • Vector Selection: Plasmid vectors containing strong promoters compatible with E. coli expression

  • Tag Selection: N-terminal His-tag fusion for facilitating purification

  • Host Strain: E. coli strains optimized for membrane protein expression

  • Expression Conditions: Induction parameters that balance yield with proper folding

When expressing membrane proteins like YdbS, considerations must include the potential toxicity to host cells and proper membrane insertion. Researchers should monitor growth curves during expression and potentially adjust induction timing and strength to optimize protein yield while maintaining cell viability.

What are the optimal conditions for purifying recombinant YdbS?

The purification of His-tagged recombinant YdbS typically follows these methodological steps:

  • Cell Lysis: Mechanical disruption (sonication or French press) in a buffer containing mild detergents to solubilize membrane proteins

  • Affinity Chromatography: Ni-NTA or similar metal affinity resin for capturing His-tagged protein

  • Washing: Graduated imidazole concentrations to remove non-specific binding

  • Elution: Higher imidazole concentration (typically 250-500 mM)

  • Buffer Exchange: Removal of imidazole through dialysis or gel filtration

  • Storage: Lyophilization or storage in buffer containing 6% trehalose at pH 8.0

The purified protein should achieve greater than 90% purity as determined by SDS-PAGE . For long-term storage, add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity .

How can researchers determine the membrane topology of YdbS?

Determining membrane topology of YdbS requires multiple complementary techniques:

  • Computational Prediction:

    • Hydropathy plot analysis using algorithms like TMHMM, Phobius, or TOPCONS

    • Signal peptide prediction using SignalP

  • Experimental Approaches:

    • Protease Accessibility Assay: Treating intact cells with proteases to identify exposed regions

    • Cysteine Scanning Mutagenesis: Introducing cysteine residues at various positions for accessibility studies

    • GFP-Fusion Analysis: Creating N- and C-terminal GFP fusions to determine orientation

    • Split GFP Assay: Using the iSplit GFP system where the eleventh β-sheet of sfGFP is fused to specific domains of YdbS to determine localization

The iSplit GFP assay is particularly valuable as it enables in vivo detection during expression in batch cultures and analysis at the single-cell level . This methodology involves complementing a detector protein (truncated sfGFP, GFP1-10) with the eleventh β-sheet of sfGFP fused to YdbS, forming fluorescent holo-GFP when properly localized .

What methods can be used to investigate YdbS's role in antimicrobial resistance?

To investigate YdbS's role in antimicrobial resistance against B. amyloliquefaciens compounds, researchers can employ:

  • Gene Knockout Studies:

    • Generate ΔydbS strains using CRISPR-Cas9 or traditional homologous recombination

    • Compare susceptibility to antimicrobial compounds between wild-type and knockout strains

  • Complementation Assays:

    • Reintroduce ydbS gene in knockout strains to confirm phenotype restoration

    • Introduce site-directed mutations to identify critical residues

  • Resistance Profiling:

    • Minimum inhibitory concentration (MIC) determination

    • Growth inhibition zone assays

    • Time-kill kinetics

  • Interaction Studies:

    • Pull-down assays to identify YdbS interaction partners

    • Surface plasmon resonance to detect direct binding with antimicrobial compounds

    • Fluorescence-based binding assays

  • Gene Expression Analysis:

    • RT-qPCR to measure expression changes in response to antimicrobial exposure

    • RNA-seq for genome-wide expression patterns

These methodologies should be applied within a carefully designed experimental framework that includes appropriate controls and replicates to ensure statistically significant and reproducible results.

How can the iSplit GFP assay be optimized for monitoring YdbS expression and localization?

The iSplit GFP assay can be optimized for YdbS studies through the following methodological approach:

  • Strategic Tag Placement:

    • Fuse the eleventh β-sheet of sfGFP to either N- or C-terminus of YdbS based on predicted topology

    • Create internal fusions at non-critical loop regions to maintain protein function

    • Generate multiple constructs to identify optimal tag positions

  • Expression Tuning:

    • Select appropriate promoters for balanced expression of both YdbS-GFP11 and GFP1-10

    • Use inducible systems like the IPTG-inducible P(HpaII) promoter for the detector protein

    • Implement translational tuning strategies as described for the β-glucuronidase GUS model

  • Detection Optimization:

    • Synchronize expression timing between target and detector proteins

    • Optimize inducer concentrations and induction timing

    • Determine optimal cell density for imaging or fluorescence measurements

  • Advanced Analytical Methods:

    • Flow cytometry for population heterogeneity analysis

    • Microfluidic single-cell cultivation for real-time monitoring

    • Live-cell fluorescence microscopy for subcellular localization studies

This methodology allows for quantitative assessment of production levels and can reveal heterogeneity in expression among individual cells, providing insights into the factors affecting membrane protein production and localization.

What approaches can be used to study the interaction between YdbS and the CssRS two-component system during secretion stress?

Investigating the relationship between YdbS and the CssRS secretion stress response system requires:

  • Stress Induction and Monitoring:

    • Overexpress YdbS to potentially trigger secretion stress

    • Monitor activation of CssRS using reporter constructs (e.g., PhrA-lacZ or PhtrB-lacZ fusions)

    • Compare wild-type and ΔcssRS strains expressing recombinant YdbS

  • Phosphorylation State Analysis:

    • Detect CssR phosphorylation levels using Phos-tag SDS-PAGE or phospho-specific antibodies

    • Correlate with YdbS expression levels

  • Transcriptional Profiling:

    • Perform RNA-seq or microarray analysis comparing YdbS-expressing and control strains

    • Focus on expression changes in CssRS-regulated genes, including htrA and htrB

  • Co-immunoprecipitation Studies:

    • Identify potential physical interactions between YdbS and components of the stress response system

    • Use crosslinking approaches for transient interactions

  • Localization Studies:

    • Determine co-localization patterns of YdbS with CssS sensor kinase using fluorescent fusion proteins

    • Employ super-resolution microscopy techniques for precise spatial relationships

The CssRS two-component system responds to secretion stress by regulating expression of quality control proteases HtrA and HtrB . Understanding YdbS's interaction with this system could provide insights into how membrane protein overexpression affects cellular homeostasis and protein quality control mechanisms.

How should researchers design experiments to optimize YdbS expression using Design of Experiments (DoE) methodology?

Implementing DoE for optimizing YdbS expression requires a systematic approach:

  • Factor Identification:
    Key parameters to consider include:

    • Induction timing (OD600 at induction)

    • Inducer concentration

    • Post-induction temperature

    • Media composition

    • Duration of expression

    • Host strain selection

  • Design Selection:

    • For initial screening: Fractional factorial design to identify significant factors

    • For optimization: Response surface methodology (RSM) with central composite design

  • Response Measurement:

    • Define clear metrics for success (protein yield, purity, activity)

    • Implement standardized analytical methods (Western blot, SDS-PAGE, activity assays)

  • DoE Implementation Matrix:

ExperimentTemperature (°C)IPTG (mM)Induction OD600Harvest Time (h)Media Type
1180.10.616LB
2300.10.64TB
3181.00.64TB
4301.00.616LB
5180.11.24LB
6300.11.216TB
7181.01.216TB
8301.01.24LB
9240.550.9102YT
  • Statistical Analysis:

    • Analysis of variance (ANOVA) to identify significant factors and interactions

    • Regression modeling to develop predictive equations

    • Response surface analysis to identify optimal conditions

The DoE approach enables researchers to systematically assess the individual and collective effects of varying experimental parameters with fewer experiments than traditional one-factor-at-a-time approaches . This methodology aligns with Quality by Design (QbD) principles, embedding quality into the process from the beginning by identifying critical process parameters (CPPs) that influence critical quality attributes (CQAs) of the recombinant protein .

What control experiments are essential when studying YdbS function and expression?

To ensure scientific rigor in YdbS research, the following controls are essential:

  • Expression Controls:

    • Empty vector control (same backbone without ydbS gene)

    • Expression of non-related membrane protein using identical conditions

    • Expression of soluble control protein to assess general expression capacity

  • Functional Analysis Controls:

    • YdbS knockout strain (negative control)

    • Complemented knockout strain (restoration control)

    • Site-directed mutants affecting key functional domains

    • Inactive protein variant (e.g., with critical residues mutated)

  • Localization Controls:

    • Known membrane protein with similar topology (positive control)

    • Cytoplasmic protein fusion (negative control for membrane localization)

    • Periplasmic protein control for secretion studies

  • Technical Controls:

    • Non-induced samples for background expression

    • Time-course samples to track expression kinetics

    • Replicate cultures to assess reproducibility

    • Standard curve for quantification assays

Following the experimental design principles outlined in research methodology guidelines , these controls help to eliminate alternative explanations and confirm that observed effects are specifically attributable to YdbS expression or function rather than experimental artifacts.

How can researchers resolve contradictory data in YdbS functional studies?

When confronting contradictory data in YdbS research, apply this systematic resolution framework:

  • Identify Inconsistency Patterns:

    • Categorize contradictions using anti-pattern analysis to generalize contradictions across datasets

    • Determine if contradictions are methodological, biological, or interpretational

  • Methodological Reconciliation:

    • Re-examine experimental conditions and protocols for subtle differences

    • Standardize methodologies across comparative studies

    • Identify critical parameters that might explain divergent results

  • Statistical Approach:

    • Apply meta-analysis techniques to integrate conflicting data

    • Use Bayesian methods to update confidence in hypotheses as new data emerges

    • Implement sensitivity analysis to identify result-driving factors

  • Resolution Framework:

Contradiction TypeInvestigation ApproachResolution Strategy
Functional roleIndependent validation with orthogonal methodsDetermine context-dependent effects
Expression levelStandardize quantification methodsAccount for strain-specific differences
LocalizationCompare preparation methodsRefine compartment fractionation protocols
Protein interactionsValidate using multiple interaction assaysMap condition-specific interaction networks
Phenotypic effectsControl for genetic backgroundIdentify epistatic interactions
  • Knowledge Integration:

    • Develop unified models that accommodate seemingly contradictory observations

    • Apply justification retrieval to find minimal sets of statements leading to contradictions

    • Consider whether contradictions reveal new biological complexity rather than errors

This approach acknowledges that logical inconsistencies in knowledge graphs about biological systems often reveal important biological nuances rather than simple errors . Careful analysis of these contradictions can lead to refined hypotheses and deeper understanding of YdbS function.

What statistical approaches are most appropriate for analyzing YdbS expression data from single-cell studies?

For single-cell YdbS expression analysis, robust statistical frameworks should be employed:

  • Distribution Analysis:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Apply appropriate transformations (log, Box-Cox) for skewed distributions

    • Use kernel density estimation for multimodal distributions

  • Population Heterogeneity Characterization:

    • Implement mixture modeling to identify subpopulations

    • Calculate coefficient of variation (CV) to quantify expression noise

    • Apply clustering algorithms (k-means, hierarchical, DBSCAN) to identify expression patterns

  • Comparative Statistical Tests:

    • For normally distributed data: t-tests, ANOVA with post-hoc tests

    • For non-parametric comparisons: Mann-Whitney U, Kruskal-Wallis with Dunn's post-test

    • For multivariate analysis: MANOVA, principal component analysis (PCA)

  • Time-Series Analysis for Live-Cell Imaging:

    • Employ autocorrelation functions to detect oscillatory patterns

    • Use hidden Markov models to identify state transitions

    • Apply Gaussian process regression for temporal trends

  • Spatial Statistics for Localization:

    • Ripley's K function for spatial clustering

    • Cross-correlation analysis for co-localization

    • Nearest neighbor analysis for distributional patterns

When applying these methods to data from techniques like flow cytometry or microfluidic single-cell cultivation combined with fluorescence microscopy , researchers can rigorously characterize cell-to-cell variability in YdbS expression, localization, and function. This approach recognizes that population averages often mask important biological heterogeneity that may have functional consequences.

What are the common challenges in expressing recombinant YdbS and how can they be overcome?

Common challenges and their solutions include:

  • Low Expression Levels:

    Challenges:

    • Toxicity to host cells

    • Inefficient translation

    • Protein instability

    Solutions:

    • Use tightly regulated expression systems

    • Optimize codon usage for the host organism

    • Co-express molecular chaperones

    • Lower induction temperature (18-25°C)

    • Try different fusion tags (His, GST, MBP)

  • Improper Membrane Insertion:

    Challenges:

    • Protein aggregation

    • Inclusion body formation

    • Improper folding

    Solutions:

    • Include mild detergents during expression

    • Try specialized E. coli strains for membrane proteins

    • Optimize signal sequence if applicable

    • Consider in vitro translation systems

    • Implement a split GFP assay to monitor proper localization

  • Purification Difficulties:

    Challenges:

    • Co-purification of host proteins

    • Detergent interference with binding

    • Protein instability during purification

    Solutions:

    • Optimize detergent type and concentration

    • Include additional washing steps

    • Try tandem affinity purification

    • Optimize buffer composition (pH, salt, additives)

    • Include protease inhibitors throughout purification

The iSplit GFP assay is particularly valuable for troubleshooting, as it enables in vivo monitoring of protein production and localization at both population and single-cell levels . This approach allows researchers to quickly assess whether modifications to expression conditions are improving proper membrane insertion.

How can researchers minimize secretion stress when expressing recombinant YdbS in B. subtilis?

To minimize secretion stress during YdbS expression in B. subtilis:

  • CssRS System Management:

    • Monitor activation of the CssRS two-component system using reporter constructs

    • Co-express a proteolytically inactive form of HtrA to provide chaperone activity without degradation

    • Fine-tune expression levels to balance yield with stress response

  • Expression Strategy Optimization:

    • Select appropriate signal peptides compatible with YdbS

    • Use moderately strong rather than very strong promoters

    • Implement inducer titration to find optimal expression levels

    • Consider pulse-expression strategies rather than continuous induction

  • Host Strain Engineering:

    • Use strains with enhanced protein folding capacity

    • Consider protease-deficient strains to reduce degradation

    • Implement genomic modifications to upregulate specific chaperones

  • Process Optimization:

    • Adjust culture conditions (temperature, media composition, aeration)

    • Implement fed-batch cultivation to control growth rate

    • Optimize induction timing based on growth phase

Co-expression of a proteolytically inactive form of the quality control protease HtrA has been shown to provide chaperone activity without degradation, enhancing bacterial fitness and recombinant protein yield . This approach leverages the dual function of HtrA in protein quality control, utilizing its chaperone-like activity while eliminating its protease function, which can be particularly valuable for membrane proteins like YdbS.

What emerging technologies could advance our understanding of YdbS structure and function?

Several cutting-edge technologies offer promising approaches for YdbS research:

  • Structural Biology Advancements:

    • Cryo-Electron Microscopy: Near-atomic resolution structures of membrane proteins without crystallization

    • Integrative Structural Biology: Combining X-ray crystallography, NMR, and computational methods

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Probing dynamic structural features and conformational changes

  • Functional Genomics Approaches:

    • CRISPR Interference (CRISPRi): Precise downregulation of ydbS expression

    • Genome-Wide Interaction Screens: Identifying genetic interactions using CRISPRi-based approaches

    • Transposon Sequencing (Tn-Seq): Mapping genetic interactions in various stress conditions

  • Advanced Imaging:

    • Super-Resolution Microscopy: Nanoscale visualization of YdbS localization and dynamics

    • Single-Molecule Tracking: Real-time monitoring of YdbS movement within membranes

    • Correlative Light and Electron Microscopy (CLEM): Combining functional and ultrastructural information

  • Systems Biology Integration:

    • Multi-Omics Integration: Combining transcriptomics, proteomics, and metabolomics data

    • Flux Balance Analysis: Modeling metabolic impacts of YdbS function

    • Machine Learning Approaches: Pattern recognition in complex datasets

These emerging technologies, when applied to YdbS research, could reveal unprecedented insights into its structural dynamics, functional interactions, and regulatory networks, potentially uncovering novel applications in antimicrobial resistance research and protein engineering.

How might understanding YdbS contribute to broader advances in membrane protein research?

YdbS research can impact broader membrane protein research through:

  • Methodological Advances:

    • Optimization of expression and purification protocols transferable to other challenging membrane proteins

    • Refinement of the iSplit GFP assay as a generalizable tool for membrane protein visualization

    • Development of strategies to minimize secretion stress applicable to diverse protein production systems

  • Theoretical Contributions:

    • Improved understanding of membrane protein folding and quality control mechanisms

    • Insights into bacterial antimicrobial resistance strategies

    • Models for transmembrane topology prediction and validation

  • Translational Applications:

    • Design of novel antimicrobial compounds targeting resistance mechanisms

    • Engineering of robust bacterial strains for bioproduction

    • Development of biosensors using transmembrane proteins

  • Interdisciplinary Connections:

    • Integration of computational modeling with experimental validation

    • Application of Design of Experiments (DoE) methodology to biological systems

    • Cross-organism comparison of similar membrane protein families

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.