Recombinant Bacillus subtilis UPF0699 transmembrane protein ydbT (ydbT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
ydbT; BSU04600; UPF0699 transmembrane protein YdbT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydbT
Target Protein Sequence
MMSEPKRLHPVAVILNLCHTIIQTIKNIILPFFFVYIVNSNHTVRFYGAIALGVLFIWLV AASIIKWRRFTYRIEDDEFRIEEGLFVTKKRYISIDRIQTMNTSAGLVQQIFKLVKLQIE TAGGGKEAEAVLSAISVEEAERIKEAVFKKKAQRRENELDEERLEAEEELDPSVEVQEHY RMNAKELLMAASTSGGIGVIISAVFALISQLDEVLPMDWLFDKFSFLQHASIGIYAVLIF IGLFIAWIFSIAGMMFRYANFQIIKKEQELVISRGIIEKHQVTIPLRKIQAIKIKENIIR QLFGFVTVSIVSAGGGDREKEEGALTILFPMIHKKKLPHMLRTFTPEYTLEENCRRLPRR ALKRYLFRSVIFSLFLIIPLCIFFQPWGYLSVILLPIELLFGYLAYKEAAWTINGDRLQL TSRFIGRTTAIVLKKRMQVCKFSQSYFQKKGRLYTISTSVKSSSHMEELTVRDVGEEDAA FILKWYSYEKADG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0699 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended expression systems for recombinant ydbT protein?

While ydbT is native to Bacillus subtilis, recombinant expression is typically performed in E. coli for research purposes. E. coli offers several advantages including:

  • Established protocols for membrane protein expression

  • Availability of specialized strains for membrane protein production

  • Compatibility with affinity tags (particularly His-tags) for purification

  • Higher yield potential compared to native expression

The recommended expression system includes:

  • E. coli host strain optimized for membrane protein expression

  • N-terminal His-tag for purification

  • Temperature-controlled expression (typically 16-30°C)

  • Induction conditions optimized to prevent protein aggregation

For researchers requiring endotoxin-free preparations or interested in exploring alternative expression systems, B. subtilis itself can serve as an effective expression host with advantages including:

  • Natural competence for DNA uptake

  • Efficient homologous recombination

  • Faster growth rates (20-minute doubling time at 30-35°C)

  • Shorter fermentation cycles (~48 hours compared to ~180 hours for yeast)

  • Efficient protein secretion capabilities

What purification strategies are most effective for recombinant ydbT protein?

Given the hydrophobic nature of membrane proteins like ydbT, effective purification requires specialized approaches:

  • Initial extraction: Membrane proteins require careful solubilization with detergents. Recommended detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl-β-D-glucopyranoside (OG)

    • Digitonin for more gentle extraction

  • Affinity purification: Utilizing the N-terminal His-tag, immobilized metal affinity chromatography (IMAC) serves as the primary purification step, typically with Ni-NTA resin .

  • Secondary purification: Size exclusion chromatography (SEC) is recommended to remove aggregates and achieve higher purity.

  • Storage recommendations: The purified protein should be:

    • Stored at -20°C/-80°C

    • Aliquoted to avoid repeated freeze-thaw cycles

    • Reconstituted in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

    • For long-term storage, addition of 5-50% glycerol (50% being the default concentration)

How can researchers optimize expression conditions for maximum yield of functional ydbT protein?

Optimizing expression conditions for membrane proteins like ydbT requires balancing protein production with proper folding and membrane integration:

  • Expression temperature optimization:

    • Test expression at 16°C, 25°C, and 30°C

    • Lower temperatures (16-25°C) often favor proper folding of membrane proteins

    • Monitor protein quality alongside quantity at each temperature

  • Induction optimization:

    • Test IPTG concentrations ranging from 0.1-1.0 mM

    • Consider auto-induction media which can provide gentler induction

    • Test induction at different cell densities (OD600 0.4-0.8)

  • Media composition:

    • Enriched media (such as 2XYT or TB) can improve yields

    • Supplementation with glucose (0.5-1%) may reduce leaky expression

    • For B. subtilis expression, optimize carbon and nitrogen sources based on metabolic efficiency

  • Gene design and codon optimization:

    • Implementation of optimized gene design algorithms can significantly improve expression levels

    • Selection of appropriate secretion signal peptides when expressing in B. subtilis

    • Consider testing a library of secretion signal peptides to identify optimal combinations for your specific construct

When expressing in B. subtilis, consider testing protease-deficient strains to reduce degradation of the target protein, as B. subtilis has robust proteolytic systems that can reduce recombinant protein yields .

What analytical methods are recommended for assessing ydbT protein localization in Bacillus subtilis?

Based on research on other membrane proteins in B. subtilis, several analytical methods can effectively characterize ydbT localization:

  • Fluorescent protein fusion approach:

    • Generate C-terminal or N-terminal GFP/YFP/mCherry fusions

    • Ensure fusion does not disrupt membrane targeting sequences

    • Use fluorescence microscopy to visualize localization patterns

    • Expect discrete domains rather than homogeneous distribution across the membrane

  • 3D reconstruction:

    • Z-stack imaging and deconvolution for detailed localization analysis

    • Appropriate for determining if ydbT shows preference for specific cellular regions (poles, septum, etc.)

    • Previous studies with other membrane proteins showed domains were not regular and had no bias for specific positions

  • Dual-labeling approaches:

    • Co-localization studies with known membrane proteins (e.g., ATP synthase)

    • Use different colored fluorescent proteins to track multiple proteins simultaneously

    • Quantify co-localization using statistical methods

  • Dynamic localization assessment:

    • Time-lapse microscopy to track protein movement

    • Fluorescence recovery after photobleaching (FRAP) to measure diffusion rates

    • Previous studies with other B. subtilis membrane proteins revealed highly dynamic but random localization patterns

Analytical MethodApplicationExpected OutcomeTechnical Considerations
Fluorescent protein fusionBasic localizationDiscrete domains within membraneMay affect protein function
3D reconstructionDetailed spatial distributionThree-dimensional localization patternRequires specialized microscopy
Dual-labelingCo-localization analysisPartial overlap with other membrane proteinsSpectral separation is critical
Time-lapse imagingDynamic behaviorDiffusion patterns within membranePhotobleaching must be minimized

What approaches are recommended for analyzing potential interactions between ydbT and other membrane proteins?

To investigate protein-protein interactions involving membrane proteins like ydbT:

  • Co-immunoprecipitation (Co-IP) with proper detergent solubilization:

    • Use anti-His antibodies to pull down His-tagged ydbT

    • Analyze co-precipitated proteins via mass spectrometry

    • Validate with reciprocal Co-IP using antibodies against putative partners

  • Bacterial two-hybrid (BTH) system:

    • Modified BTH systems designed specifically for membrane proteins

    • Test interactions with known membrane proteins from the same cellular compartment

    • Quantify interaction strength using β-galactosidase assays

  • Förster resonance energy transfer (FRET):

    • Generate fusions with appropriate FRET pairs (e.g., CFP-YFP)

    • Measure energy transfer as indicator of proximity

    • Use acceptor photobleaching to confirm FRET signal validity

  • Cross-linking coupled with mass spectrometry:

    • Apply membrane-permeable crosslinkers

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides using specialized software

These approaches should be employed complementarily, as each has distinct strengths and limitations when applied to membrane proteins.

How can researchers assess the functional significance of ydbT in Bacillus subtilis?

To determine the functional role of ydbT in B. subtilis:

  • Gene knockout/knockdown approaches:

    • Create clean gene deletions using Cre/lox system

    • Follow established knockout methods with appropriate antibiotic selection markers

    • Analyze the resulting phenotype under various growth conditions

  • Complementation studies:

    • Reintroduce wild-type or mutated versions of ydbT to knockout strains

    • Assess restoration of phenotype to confirm specificity

    • Use inducible promoters to control expression levels

  • Phenotypic assays:

    • Growth curves under various stress conditions

    • Cell morphology analysis

    • Membrane integrity assessments

    • Metabolic profiling

  • Transcriptome analysis:

    • RNA-seq to identify genes differentially expressed in knockout strains

    • Pathway enrichment analysis to identify affected cellular processes

    • qRT-PCR validation of key differentially expressed genes

Given that lifespan engineering strategies have been effective in B. subtilis chassis development, investigating how ydbT deletion affects chronological and replicative lifespans would be particularly informative .

What strategies can be employed to investigate structure-function relationships in ydbT protein?

To explore the relationship between ydbT structure and function:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Focus on predicted functional domains and transmembrane regions

    • Create alanine-scanning libraries across regions of interest

    • Assess mutant function through complementation of knockout strains

  • Domain swapping/deletion:

    • Generate truncated constructs to identify minimal functional units

    • Create chimeric proteins with domains from related proteins

    • Express and purify for in vitro functional assays

  • Topology mapping:

    • Cysteine accessibility studies to determine membrane-spanning regions

    • Reporter fusion analysis at various positions to determine orientation

    • Computational prediction validation through experimental approaches

  • Structural studies:

    • Cryo-electron microscopy for membrane protein complexes

    • X-ray crystallography requiring specialized crystallization techniques

    • NMR studies of isolated domains or peptide fragments

A systematic approach combining these strategies can provide comprehensive insights into structure-function relationships in this poorly characterized transmembrane protein.

How might ydbT function in membrane domain organization in Bacillus subtilis?

Given that membrane proteins in B. subtilis localize to discrete domains rather than being homogeneously distributed , ydbT may play a role in membrane organization:

  • Potential roles in membrane microdomains:

    • Scaffold protein for membrane domain assembly

    • Regulator of membrane fluidity or curvature

    • Coordinator of multiprotein complexes within the membrane

  • Investigation approaches:

    • Super-resolution microscopy to visualize nanoscale domain structure

    • Lipid raft isolation and proteomic analysis

    • Protein diffusion measurements in wild-type vs. ydbT-deficient strains

    • Analysis of co-localization with known domain markers

  • Functional implications:

    • Impact on signal transduction across the membrane

    • Potential involvement in cell division or chromosome segregation

    • Role in adaptation to environmental stresses through membrane reorganization

Research on other bacterial membrane proteins suggests dynamic but non-random localization patterns that may be critical for cellular functions . Similar studies with ydbT could reveal its contribution to these spatially organized processes.

How can ydbT be integrated into synthetic biology applications for Bacillus subtilis?

As synthetic biology applications for B. subtilis continue to expand, ydbT could be utilized in several ways:

  • Chassis cell development:

    • Evaluation of ydbT as a target for modification in B. subtilis chassis strains

    • Assessment of ydbT deletion or overexpression on cell robustness

    • Integration into lifespan engineering strategies for improved industrial production

  • Membrane protein display systems:

    • Utilization of ydbT as a scaffold for surface display of enzymes or binding proteins

    • Development of whole-cell catalysts with membrane-associated activities

    • Creation of biosensors through fusion with reporter domains

  • Bioprocess optimization:

    • Manipulation of ydbT expression to alter membrane properties

    • Enhancement of substrate uptake or product export

    • Improvement of cellular stress tolerance during fermentation

  • Heterologous expression platform:

    • Leveraging B. subtilis as an endotoxin-free expression system

    • Optimization of secretion signal peptides for improved protein translocation

    • Development of protease-deficient strains for enhanced protein stability

The natural competence of B. subtilis for DNA uptake and efficient homologous recombination makes it particularly suitable for genetic manipulation and adaptation to different manufacturer requirements, positioning it as an excellent chassis for synthetic biology applications .

What emerging technologies might advance our understanding of ydbT function and applications?

Several cutting-edge technologies show promise for deepening our understanding of ydbT:

  • CRISPR-based approaches:

    • CRISPRi for tunable knockdown of ydbT expression

    • CRISPR-based genetic screens to identify functional partners

    • Base editors for precise introduction of point mutations

    • Implementation of MAD7 enzyme systems for genome editing

  • Single-molecule tracking:

    • Visualization of individual ydbT proteins in living cells

    • Characterization of diffusion coefficients and confined movement

    • Identification of interaction dynamics with other membrane components

  • Integrative multi-omics:

    • Combining proteomics, lipidomics, and metabolomics data

    • Network analysis to position ydbT within cellular systems

    • Machine learning approaches to predict functional roles

  • High-throughput screening platforms:

    • Library of secretion signal peptides to optimize expression

    • Systematic testing of promoters and gene copy numbers

    • Protease-deficient strain panels for improved protein stability

TechnologyApplication to ydbT ResearchExpected BenefitsCurrent Limitations
CRISPR systemsPrecise genetic manipulationTargeted modification with minimal off-target effectsDelivery efficiency in B. subtilis
Single-molecule trackingDynamic behavior analysisUnprecedented spatial and temporal resolutionTechnical complexity and specialized equipment
Multi-omics integrationSystems-level understandingHolistic view of protein functionData integration challenges
High-throughput screeningOptimized expression conditionsRapid identification of optimal parametersResource-intensive setup

What are common challenges in working with recombinant ydbT and how can they be addressed?

Membrane proteins like ydbT present several challenges that researchers should anticipate:

  • Low expression levels:

    • Solution: Test multiple expression strains and growth conditions

    • Try different fusion tags beyond His-tag (MBP, SUMO)

    • Optimize codon usage for the expression host

    • Consider auto-induction media for gentler protein expression

  • Protein aggregation:

    • Solution: Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Include stabilizing agents (glycerol, specific detergents)

    • Consider fusion partners known to enhance solubility

  • Inefficient membrane integration:

    • Solution: Test different signal sequences

    • Optimize the composition of the growth medium

    • Consider specialized host strains with enhanced membrane protein expression capabilities

    • When using B. subtilis, test the library of 94 diverse secretion signal peptides

  • Proteolytic degradation:

    • Solution: Include protease inhibitors during purification

    • Use protease-deficient expression strains

    • Optimize buffer conditions to minimize proteolysis

    • When expressing in B. subtilis, consider protease-deficient strains to counter its robust proteolytic systems

  • Detergent selection challenges:

    • Solution: Screen multiple detergents for extraction efficiency

    • Perform stability tests in different detergents

    • Consider amphipols or nanodiscs for improved stability

    • Test detergent mixtures for optimal solubilization

How should researchers design experiments to study ydbT localization and dynamics?

Based on studies of other membrane proteins in B. subtilis, effective experimental design for ydbT should include:

  • Fluorescent protein fusion considerations:

    • Test both N- and C-terminal fusions to determine which maintains functionality

    • Use linker sequences to minimize interference with protein folding

    • Validate that fusion proteins retain wild-type localization and function

    • Be aware that membrane proteins in B. subtilis localize within discrete domains rather than homogeneously

  • Imaging parameters:

    • Optimize exposure times to minimize photobleaching

    • Use minimal excitation intensity compatible with good signal-to-noise ratio

    • Acquire Z-stacks for 3D reconstruction

    • Implement deconvolution algorithms to enhance spatial resolution

  • Time-lapse considerations:

    • Balance temporal resolution with photobleaching/phototoxicity

    • Include appropriate controls for cell viability during imaging

    • Design custom sample chambers to maintain physiological conditions

    • Be prepared to observe dynamic, random localization patterns as seen with other B. subtilis membrane proteins

  • Data analysis approaches:

    • Quantify protein distribution using line-scan analysis

    • Apply segmentation algorithms to identify membrane domains

    • Use tracking software for dynamic studies

    • Implement statistical methods to distinguish random from directed motion

By implementing these methodological considerations, researchers can generate reliable data on ydbT localization and dynamics while avoiding common technical pitfalls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.