Recombinant Bacillus subtilis UPF0700 transmembrane protein yoaK (yoaK)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant YoaK is produced in multiple expression systems with standardized protocols:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free systems
Purity≥85% (SDS-PAGE verified)
TagN-terminal 10xHis tag (common)
Storage-20°C (short-term); -80°C (long-term); avoid freeze-thaw cycles
Expression RegionFull-length (1–225 amino acids) or partial constructs

Functional Insights

  • Unknown Primary Role: YoaK remains uncharacterized functionally, though its genomic context and transmembrane nature suggest potential roles in membrane-associated processes .

  • Genetic Tools: Mutant strains (yoaK::erm, yoaK::kan) are available for knockout studies (BGSC and NBRP) .

Technological Utility

  • Genetic Code Expansion: Studies in B. subtilis using non-standard amino acids (e.g., photocrosslinkers) highlight methodologies applicable to YoaK for probing interactions or structural dynamics .

  • Membrane Protein Studies: YoaK’s transmembrane topology makes it a candidate for investigating membrane protein folding and localization mechanisms .

Open Questions and Future Directions

  • Functional Elucidation: High-priority goals include identifying binding partners, enzymatic activity, or regulatory roles.

  • Structural Biology: Cryo-EM or X-ray crystallography could resolve its 3D structure, aiding mechanistic studies.

  • Comparative Genomics: Homologs in Bacillus licheniformis and Bacillus amyloliquefaciens (COG3619 family) may provide evolutionary insights .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yoaK; BSU18640; UPF0700 transmembrane protein YoaK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yoaK
Target Protein Sequence
MTAAAYRNTLLSLLCLTAGIVDVIGYLSLGHVFTANMTGNIVLLGLAIGKSIQVTVFNSL TALIGFICGVIIATLMVGKAENTLWPSAVTKALALEAFILFVFACLSFYRAFVPVHILII LMSISMGIQTTAAKKLGIAGISSTVLTGTLASLLEDISGRLFFKKQKKTFLRDTVLRALA IILYCVGAIIVALAEPDFYHFIIWVPIVLIFGIMMTAKLKLSGEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0700 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the Bacillus subtilis UPF0700 transmembrane protein yoaK?

The UPF0700 transmembrane protein yoaK is a hypothetical protein from Bacillus subtilis subsp. subtilis str. 168 . As a transmembrane protein, it is embedded within the bacterial cell membrane, with portions extending into both the cytoplasm and extracellular space. The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein has been identified, its specific biological function remains incompletely characterized.

To elucidate this protein's function, researchers typically employ a combination of:

  • Bioinformatic approaches (sequence homology analysis and structural predictions)

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction assays to identify binding partners

  • Localization studies using fluorescent tags to confirm membrane positioning

How stable is the recombinant yoaK protein under laboratory conditions?

Based on available storage recommendations, recombinant yoaK protein demonstrates moderate stability under standard laboratory conditions. For short-term use, the protein can be stored at +4°C, while long-term storage requires temperatures between -20°C and -80°C . The protein is typically supplied in PBS buffer to maintain stability.

Stability considerations for experimental planning:

  • Minimize freeze-thaw cycles (aliquot upon receipt)

  • Working concentration should be optimized for each experimental system

  • Protein activity may decrease over time, even under optimal storage conditions

  • Stability assays (e.g., circular dichroism, thermal shift) are recommended for long-term studies

What expression systems are most effective for producing recombinant yoaK protein?

According to product specifications, recombinant Bacillus subtilis yoaK protein can be successfully produced in either E. coli or yeast expression systems . Each system offers distinct advantages:

Expression SystemAdvantagesLimitations
E. coli- Higher protein yields
- Cost-effective
- Rapid expression
- May form inclusion bodies
- Limited post-translational modifications
- Potential endotoxin contamination
Yeast- Eukaryotic post-translational modifications
- Often better protein folding
- Lower endotoxin concerns
- Lower yield
- Longer production time
- More complex media requirements

For transmembrane proteins like yoaK, specialized E. coli strains (C41, C43) designed for membrane protein expression may improve solubility and yield.

What structural and functional domains characterize the UPF0700 family of transmembrane proteins?

The UPF0700 family represents a group of transmembrane proteins with conserved structural features. While specific domain information for yoaK is limited in the available data, transmembrane proteins typically contain:

  • Hydrophobic transmembrane domains that span the lipid bilayer

  • Hydrophilic loops connecting the transmembrane segments

  • Cytoplasmic and periplasmic/extracellular domains with potential functional motifs

Research approaches to characterize these domains include:

  • Membrane topology prediction algorithms

  • Limited proteolysis coupled with mass spectrometry

  • Site-directed mutagenesis of conserved residues

  • Cryo-electron microscopy or X-ray crystallography for structural determination

How does the His-tag affect the function and structure of recombinant yoaK protein in experimental applications?

The recombinant Bacillus subtilis yoaK protein is available with a His-tag , which facilitates purification but may influence protein behavior. Researchers should consider:

Potential impacts of His-tagging:

  • May alter protein folding or oligomerization

  • Could interfere with protein-protein interactions

  • Might affect membrane insertion orientation

  • May change protein stability or solubility

Methodological considerations:

  • Cleavable His-tags with protease recognition sites allow tag removal after purification

  • Control experiments comparing tagged and untagged versions validate functional integrity

  • Alternative tag positions (N-terminal vs. C-terminal) may minimize functional disruption

  • Tag-free approaches using native purification techniques might be necessary for certain applications

What is the role of yoaK in bacterial stress response pathways?

While specific information about yoaK's role in stress response is not explicitly provided in the available data, transmembrane proteins in bacteria often participate in sensing and responding to environmental stressors. To investigate this:

  • Differential expression analysis: Compare yoaK expression levels under various stress conditions (heat shock, osmotic stress, nutrient limitation) using RT-qPCR or RNA-seq

  • Phenotypic assessment: Evaluate growth curves, survival rates, and morphological changes in wild-type versus yoaK knockout strains under stress conditions

  • Interactome mapping: Identify protein interaction partners using pull-down assays coupled with mass spectrometry to place yoaK within stress response networks

  • Membrane integrity studies: Assess membrane permeability and potential changes in membrane composition in response to yoaK expression modulation

What purification strategies optimize yield and purity for recombinant yoaK protein?

The recombinant yoaK protein, available with a His-tag, can be purified to >80% purity as determined by SDS-PAGE . Researchers can implement the following purification strategy:

Recommended purification workflow:

  • Cell lysis optimization:

    • For transmembrane proteins, detergent selection is critical

    • Test mild detergents (DDM, LMNG, Triton X-100) at various concentrations

    • Sonication parameters should be optimized to avoid protein denaturation

  • Immobilized metal affinity chromatography (IMAC):

    • Utilize Ni-NTA or Co-based resins for His-tagged protein binding

    • Implement step gradients of imidazole (20-500 mM) for elution

    • Add low concentrations of detergent in all buffers to maintain solubility

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric from oligomeric forms

    • Ion exchange chromatography for removal of remaining contaminants

    • Consider amphipol or nanodisc reconstitution for long-term stability

  • Quality control:

    • Verify purity by SDS-PAGE (target >90% for structural studies)

    • Confirm protein identity by western blot or mass spectrometry

    • Assess endotoxin levels using LAL assay (should be <1.0 EU per μg)

How can researchers effectively study protein-protein interactions involving the yoaK transmembrane protein?

Investigating protein-protein interactions for membrane proteins presents unique challenges. The following methodologies are particularly suitable for yoaK:

  • Crosslinking coupled with mass spectrometry:

    • Use membrane-permeable crosslinkers (DSS, BS3)

    • Implement on-bead digestion protocols for crosslinked complexes

    • Analyze using LC-MS/MS with specialized crosslink identification software

  • Split reporter systems:

    • BRET (Bioluminescence Resonance Energy Transfer)

    • Split-GFP or split-luciferase complementation assays

    • Bacterial two-hybrid systems adapted for membrane proteins

  • Co-immunoprecipitation adaptations:

    • Detergent screening to preserve interactions while solubilizing membranes

    • GraFix gradient fixation technique to stabilize transient interactions

    • Proximity-dependent biotinylation (BioID or TurboID) for in vivo interaction mapping

  • Computational predictions:

    • Sequence-based interaction prediction algorithms

    • Molecular docking simulations

    • Co-evolution analysis of potentially interacting partners

What are the optimal experimental conditions for assessing yoaK localization and dynamics in bacterial cells?

To effectively study the localization and dynamics of yoaK in its native cellular context:

Live-cell imaging approaches:

  • Fluorescent protein fusions (careful placement to minimize functional disruption)

  • SNAP-tag or Halo-tag labeling for super-resolution microscopy

  • Split-GFP systems for validation of membrane topology

Fixation and immunolabeling protocols:

  • Optimize fixation conditions to preserve membrane architecture

  • Use detergent permeabilization titrations to access epitopes while maintaining structure

  • Implement super-resolution techniques (STORM, PALM) for precise localization

Fractionation and biochemical verification:

  • Sucrose gradient ultracentrifugation for membrane separation

  • Protease protection assays to determine orientation

  • Alkaline carbonate extraction to distinguish peripheral from integral membrane proteins

Dynamic studies:

  • Fluorescence recovery after photobleaching (FRAP) to assess mobility

  • Single-particle tracking for diffusion coefficient determination

  • Inducible expression systems to monitor de novo insertion into membranes

How should researchers approach contradictory results when studying yoaK function across different experimental systems?

When investigating transmembrane proteins like yoaK, contradictory results often emerge due to the complexity of membrane protein biology. A systematic approach includes:

  • Systematic comparison of experimental conditions:

    • Create a comprehensive table documenting all variables (detergents, buffer compositions, expression systems)

    • Identify pattern correlations between conditions and observed outcomes

  • Multiple orthogonal techniques:

    • Validate findings using complementary methodologies

    • Prioritize techniques that maintain the protein in its native membrane environment

  • Control experiments:

    • Include positive and negative controls in all experimental designs

    • Utilize structurally related proteins with known functions as benchmarks

  • Statistical robustness:

    • Implement appropriate statistical tests for reproducibility assessment

    • Determine minimum sample sizes through power analysis

    • Consider Bayesian approaches for integrating conflicting datasets

What bioinformatic tools and databases are most useful for predicting yoaK protein interactions and functions?

To leverage computational approaches in yoaK research:

Specialized databases:

  • UniProt (ID: O34343) for sequence information and annotations

  • TCDB (Transporter Classification Database) for functional classification

  • TOPCONS for consensus membrane topology predictions

  • STRING for protein-protein interaction networks

Analysis tools:

  • TMHMM, HMMTOP for transmembrane domain prediction

  • SignalP for signal peptide detection

  • PSIPRED for secondary structure prediction

  • AlphaFold2 for structure prediction of membrane proteins

Evolutionary analysis:

  • ConSurf for identification of conserved functional residues

  • EVcouplings for co-evolution analysis to predict structural contacts

  • Phylogenetic profiling to identify potential functional partners

What emerging technologies hold promise for better characterization of transmembrane proteins like yoaK?

Several cutting-edge approaches are transforming transmembrane protein research:

  • Cryo-electron microscopy advancements:

    • Improved detectors and processing algorithms enabling higher resolution

    • Focused ion beam milling for visualizing proteins in their native membrane environment

    • Time-resolved cryo-EM for capturing conformational states

  • Native mass spectrometry:

    • Identification of lipid-protein interactions

    • Characterization of intact membrane protein complexes

    • Determination of stoichiometry and binding partners

  • Integrative structural biology:

    • Combining low-resolution (SAXS, SANS) with high-resolution (X-ray, NMR) techniques

    • Molecular dynamics simulations in explicit membrane environments

    • Cross-linking mass spectrometry for constraint-based modeling

  • Single-molecule techniques:

    • Magnetic tweezers for measuring force-dependent conformational changes

    • High-speed atomic force microscopy for dynamic surface topography

    • Single-molecule FRET for monitoring real-time conformational dynamics

How might systematic mutation analysis enhance understanding of yoaK structure-function relationships?

A comprehensive mutational analysis strategy for yoaK might include:

Scanning mutagenesis approaches:

  • Alanine scanning for identifying functionally important residues

  • Cysteine scanning accessibility method (SCAM) to map membrane topology

  • Charge introduction for probing electrostatic interactions

  • Glycine scanning to identify regions requiring conformational flexibility

Targeted mutation design:

  • Focus on conserved residues identified through multiple sequence alignment

  • Introduce mutations that alter hydrophobicity of predicted transmembrane segments

  • Create chimeric proteins with related transmembrane proteins for domain function mapping

Phenotypic readouts:

  • Growth complementation assays in knockout strains

  • Microscopy-based localization changes

  • Biochemical activity assays (if function becomes known)

  • Protein stability and folding assessment via thermal shift assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.